KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0872Help
Entry
XOC_0872          CDS       T01873                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00620  Pyruvate metabolism
xor00680  Methane metabolism
xor01100  Metabolic pathways
xor01120  Microbial metabolism in diverse environments
xor01200  Carbon metabolism
Module
xor_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOC_0872 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    XOC_0872 (ppc)
Enzymes [BR:xor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XOC_0872 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AEQ95078
UniProt: G7TDT9
LinkDB All DBs
Position
879039..881729
Genome map
AA seq 896 aa AA seqDB search
MFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAPPSTLSEQL
TGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHDALRRLKAQ
GVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRTPNERTSDA
ARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHAIEETYGSV
PALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQKELWQLASLLSQSTTL
VQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDADGAYTAPS
ELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVHARAVADAL
GQTDWDGQDATRRAAVLGPYACGQEALPRAQDEGNARLDAVFAALADARTRHGADALGSY
IISMAHNRADVLTVLALARRGGLVDAAGTVPLDIVPLFETVDDLRGGTGTVQDLLADPVY
RQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLTFFHGRGGS
IARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTGAVLLSSLR
PRAPEPREARWRPVMDLVAERSTVAYRAFVAAPEFMQYFRLATPIDVIERMTLGSRPSRR
LGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMAQDWPFFRT
FLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQQSLLQHDP
RLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGLQNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctacccccgatcttcccttgcgcgacgatgtgcgtcggctcggtgcactggtg
ggtgatctgctcgccgagcaggtgtctgcggaattcctcgatgaaatcgaacgcgtgcgc
accaccgccatctcgcggcgcgaaagcgatgccccgccctccacgttgagcgaacaactc
accgggcgcgagccgcgtgatgccgaagcgctggtgcgcgccttcagtacctatttccag
gtcgtcaatatcgccgagcgcgtgcaccgcatccgccgccgccgcgagtaccagcgcagc
ggtaccgacaccccgcagccggatggcctgcacgacgcattgcgtcggctcaaggcgcag
ggcgtgacgctggacgaactcagccagtggttgccgcgcatcgatgtggagccggtgttc
accgcgcatcccaccgaggcggtgcgccgcgcgctgctggaaaaagagcagctgatggtc
gccagcctggtcgacaacctggacggcatgcgcacgcccaatgagcgcaccagcgatgcg
gcacgtttccgcatggcgttgaccgcttcgtggcagaccgccgattcctcgccggtgcgc
cccaccgtgggcgacgagcgcgagcatgtgggcttctatctcacccaggtgctctaccgc
gtcatcccggtgatgtacgaaaccctcgaacacgccatcgaagaaacctatggcagcgtg
ccagccctgccgcgcctgctgcgtttcggcacctgggtgggcggcgacatggacggcaat
cccaatgtggatgccaacaccatcgccggcaccctggatgcacaacggcgcgcggtgctg
gaccgctatcaaaaggaactctggcagctggccagcctgctcagtcaatcgaccacgctg
gtgcaggtgagcccggaactcatgacgcagctggaacgctatcgcgcgctgctgcccgac
gccgcggcacggtcgcgtccacgtcacggcgacatgccgtaccgcctgctcaacgacctg
atgcgcgcccgcctgcaggccacactggacgatgccgacggtgcctataccgccccctct
gaactcgaagacgatctgcagttgatcctggacagcctgcaggccaacaagggcctgcac
gccggttggttcgccgtgcggcgtctgctgtggcgtgtgcgcagtttcggttttcatctg
gcgcggctggacgtgcgccaggaatcgagcgtgcatgcgcgcgcggtggccgatgccttg
ggccagaccgactgggacgggcaggacgcaacccggcgcgccgccgtgctcggcccgtat
gcctgcgggcaagaagccttgccgcgcgcgcaggatgaaggcaatgcgcggctggacgcg
gtattcgccgcgctcgccgatgcacgcacgcgccacggtgccgatgcactgggcagctac
atcatttcgatggcgcacaaccgcgccgacgtgctcactgtgctggcgctggcgcgccgc
ggcggattggtcgacgccgccggcaccgtgccgctggatatcgtgccgctgttcgaaacc
gtggacgatctgcgcggcggcaccggcacggtgcaggacctgctggccgacccggtgtat
cgccagcatctggccgcgcgcggcgatacgcagatggtgatgttggggtattcggatagc
ggcaaggacggcggcatcgccgcctcgcgctgggggctgcagcgtgcgcaggtggaactg
ctggaagccgctgccgatctgggcgtgcggctgaccttcttccacggccgtggcggttcg
atcgcgcgcggtggcggcaagaccagccgcgcgctggacgccgccccgcgcggcagcgtc
gatggccgcctgcgcgtcaccgagcagggcgaggtgatccaccgcaagtacggcatccgt
gcattggccttgcgctcgctggagcagatgaccggcgcggtgttgctttcgagcctgcgc
ccgcgtgcgcccgagccgcgcgaagcgcgctggcgtccggtgatggatctggtggccgaa
cgcagcaccgtcgcttatcgcgccttcgtcgccgcgccggagttcatgcagtacttccgc
ctggccacgccgatcgatgtgatcgaacgcatgacgctgggctcgcggccctcgcggcgg
ctggggcaggacgcggcgttgtccaacctgcgtgcgattccgtgggtgttcgcctggagc
caggcgcgtgcggtgattcccggctggtacggcgtgggcagcggcctgcaggcggcggtg
gatgccgggcatgaagacaccttgcgcgaaatggcgcaggactggccgttcttccgcacc
tttctggacgatgtcgccatggtgctgtccaagggcgatctgaatatcgccgagttgttt
tcgcgcttgtccggcgacttgcacacgcggtttttcccgctgattcgcgacgaactggcc
ttgaccaagggctgggtcaaggcactgctgcagcagcagtcgctgttgcagcacgacccg
cggctggcgttgtcgatccgcctgcgcaacccgtacatcgacccgatcagcgtgctgcag
gtagacctgctgcagcgctggcgcgctaccgatggcgaagacgaagcgctgctgcgcgcg
ctggtggcctgcgtcaacggcgtctcgcaaggtttgcagaacactggttga

DBGET integrated database retrieval system