KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0933Help
Entry
XOC_0933          CDS       T01873                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00010  Glycolysis / Gluconeogenesis
xor00053  Ascorbate and aldarate metabolism
xor00071  Fatty acid degradation
xor00280  Valine, leucine and isoleucine degradation
xor00310  Lysine degradation
xor00330  Arginine and proline metabolism
xor00340  Histidine metabolism
xor00380  Tryptophan metabolism
xor00410  beta-Alanine metabolism
xor00561  Glycerolipid metabolism
xor00620  Pyruvate metabolism
xor00625  Chloroalkane and chloroalkene degradation
xor00903  Limonene and pinene degradation
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
xor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_0933
   00053 Ascorbate and aldarate metabolism
    XOC_0933
   00620 Pyruvate metabolism
    XOC_0933
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XOC_0933
   00561 Glycerolipid metabolism
    XOC_0933
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOC_0933
   00310 Lysine degradation
    XOC_0933
   00330 Arginine and proline metabolism
    XOC_0933
   00340 Histidine metabolism
    XOC_0933
   00380 Tryptophan metabolism
    XOC_0933
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOC_0933
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOC_0933
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XOC_0933
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XOC_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEQ95139
UniProt: G7TEG0
LinkDB All DBs
Position
complement(939469..940938)
Genome map
AA seq 489 aa AA seqDB search
MEALSETLRGIPARGPLGLFIDGQWRASTGDRHIDVIAPHTQEPRLRYTEPSHADTEAAI
AAARKAFDNGPWPQLSPQERSVLLKRVAEQLRARMPELAEAWTGQVGTTIGFSKRASQQA
PDLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWNAPLILLCYTVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVDEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARIGLELGGKSAVIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRRDEILQAYCAALSAVKLGDPCAADTGMGLLALGRQLERVRSHIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEVTPDMTIAREEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttatccgaaacgctgcgcgggatccccgcgcgtggtcctctgggcttgttc
atcgacggacaatggcgcgcaagcacgggggatcgccatatcgatgtgatcgcgccgcat
acccaagaaccgcggctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaaggcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcgtgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcggcaccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccggatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaacgcgccgctgatcttgctgtgctacacggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggc
cgcgaggtggacgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcggatcggc
ctggaactgggcggcaaatcggcggtgatcgtgctggaggatgccgacatcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcgtgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtgtgccgccgataccggcatgggactgttggcgctg
ggccgccagctcgaacgcgtgcggtcccacattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaagtcacaccggacatgaccattgcgcgcgaggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcattgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgtgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system