KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0958Help
Entry
XOC_0958          CDS       T01873                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Brite
KEGG Orthology (KO) [BR:xor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XOC_0958
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XOC_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_7 FAD_binding_3 Glutaredoxin AlaDh_PNT_C Thi4 DAO FMO-like Thioredoxin_4 K_oxygenase Spermine_synth NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEQ95164
UniProt: G7TEI5
LinkDB All DBs
Position
complement(959790..961382)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDDSPGSREMLELLEELVLLSDTISLDIHRDDTQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLEGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAARRDAAKIAAKEAFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRHYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADDVLQRKLRSMHNVHIITSAQTTEVLGDG
QKVTSLVYKDRTGGAIQHIDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTNVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAHAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtgacgcggccg
attcagatcaacgcctcgatcgacgacagccctggctcgcgcgaaatgctcgaactgctg
gaagagctggtgctgttgtcggacacgatcagcctggacatccaccgcgacgacacccag
cgcaagccctcgttcgcgctgaccaccccgggccaggacatctcgctgcgcttcgccggg
ctgccgatgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggccat
ccgtccaaggcggctgccgagctgatcgagcaggtgcagcacctggaaggcgattaccag
ttcgaaacctatttctcgttgtcgtgccagaactgcccggacgtggtgcaggcactgaac
ctggccgccgtgctcaacccgcgcatcaagcacgtggccatcgacggtgcctggttccag
gacgaagtggaaacccgtcagatcatgtcggtgcccaccgtgtacttgaatggtgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctggataccaacgccgcc
aggcgcgacgctgcgaaaatcgccgcgaaagaggcgttcgacgtgctggtggtgggcggt
ggcccggccggtgcggcagcagcggtgtatgccgcacgcaagggcatccgtaccggcgtg
gccgccgaacgttttggtgggcaggtgctggacaccatgtcgatcgagaacttcatttcc
gtgccggaaaccgaaggcccgaagatggccgccgcgctcgagcaacacgtgcgccactac
gatgtggacatcatgaatctgcagcgtgccgagcagctgattccggccggtgccgatggc
ctgatcgaaatcaaactcgccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgcctggcgaggaccagtacaagaacaagggc
gttgcctactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgatgacgtgctgcaacgcaagctgcgc
agcatgcacaacgtgcacatcatcaccagcgcgcagaccaccgaagtgctcggcgacggg
cagaaggtgaccagcctggtctacaaggaccgcaccggtggcgctatccagcacatcgat
ctggaaggcgtattcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtagcgctgtcgccgcgcggcgagatcatcgtcgacgaccgcggccagaccaatgtgccg
ggcgttttcgccgccggcgacgctaccacggtgccctacaagcagatcgtgatcgcgatg
ggcgaagggtccaaggcggccctgagcgcattcgatcatctgatccgctccagcgcaccg
gccactgccgataacgtggcccacgccgcataa

DBGET integrated database retrieval system