KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_02815Help
Entry
AZ54_02815        CDS       T03765                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy00290  Valine, leucine and isoleucine biosynthesis
xoy00770  Pantothenate and CoA biosynthesis
xoy01100  Metabolic pathways
xoy01110  Biosynthesis of secondary metabolites
xoy01130  Biosynthesis of antibiotics
xoy01210  2-Oxocarboxylic acid metabolism
xoy01230  Biosynthesis of amino acids
Module
xoy_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
xoy_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AZ54_02815
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AZ54_02815
Enzymes [BR:xoy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     AZ54_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AJQ81679
LinkDB All DBs
Position
complement(583219..585057)
Genome map
AA seq 612 aa AA seqDB search
MPEYRSKTSTHGRNMAGARALWRATGMQDGDFQKPIIAIANSFTQFVPGHVHLKDLGQLV
AREIERVGGVAKEFDTIAVDDGIAMGHDGMLYSLPSREIIADSVEYMVNAHCADALVCIS
NCDKITPGMLMAALRLNIPTVFVSGGPMEAGKTALAEHKLDLIDAMVIAADDSASDEKVA
EFERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVEL
CHRWYGGEDPTALPRGIATFEAFENAMTLDIAMGGSTNTILHLLAAAQEGEVPFGMQDID
RLSKRVPQLCKVAPNTPKYHIEDVHRAGGIMAILGELARGGLLHTTAATVHARTLADAIA
HWDVTQTVDENVHTFYKAGPAGIPTQIAFSQATRWDSLDTDRSEGCIRDVAHALSQEGGL
AVLYGNIARDGCVVKTAGVDESIHVFEGTARVFESQDAAVKGILADEVKAGDVVVIRYEG
PKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGGTSGLSIGHASPEAAAGGAIGLVR
DGDKILIDIPNRGINLLISDEALASRRAEQDAKGWKPVEVRPRKVTTALKAYALLATSAD
KGAVRDKALLDG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagtaccgctccaagacctccacccacggccgcaacatggccggcgcccgcgcc
ctgtggcgtgccaccggcatgcaggacggcgacttccagaagcccatcatcgccatcgcc
aattcgttcacgcagttcgtgcccgggcatgtgcacctgaaggatcttgggcagctggtc
gcgcgcgagatcgaacgcgtcggcggcgtggccaaggagttcgacaccattgccgtggac
gacggcatcgcgatgggccacgacggcatgctgtattcgttgcccagccgcgagatcatc
gccgactcggtcgagtacatggtcaatgcgcattgcgccgatgcgctggtgtgcatttcc
aattgcgacaagatcacccccggcatgttgatggccgcgctgcggctcaatattcccacc
gtgttcgtctccggtggcccgatggaggccggcaagaccgcgttggccgagcacaaactc
gacctgatcgacgcgatggtgatcgccgccgacgacagcgcctccgatgaaaaggtggcc
gagttcgaacgcagcgcctgccccacctgtggctcctgctcgggcatgttcaccgccaac
tcgatgaactgcctgaccgaagcgctgggcctgtcgctgccgggcaacggcacggttgtc
gccacgcacgccgaccgcgagcaactgtttttgcgcgccggacgcgtggcggtggaactg
tgtcaccgctggtacggcggcgaagatcccaccgccctgccgcgcggcatcgccaccttc
gaagccttcgaaaatgcgatgacgctggatatcgccatgggtggctcgaccaacaccatc
ctgcatctgctcgctgccgcgcaggaaggcgaagtgccgttcggcatgcaggatatcgac
cgcctgtccaagcgcgtgccgcagttgtgcaaggtcgccccgaacacgccgaagtaccac
atcgaagacgtgcatcgcgccggcggcatcatggccattctcggcgaactcgcgcgcggc
ggcctgctgcataccaccgctgccaccgtgcacgcacgcacgctggccgatgccatcgcg
cactgggacgtcacccagaccgtcgatgaaaacgtgcacacgttctacaaggccggcccg
gccggcattcccacgcaaatcgccttcagccaggccacgcgttgggacagcctggatacc
gaccgcagcgaaggctgcattcgcgatgtcgcgcacgcgttgtcgcaggaaggcggcctg
gccgtgctgtacggcaatattgcccgcgatggctgcgtggtgaagactgcaggcgtggac
gaatccatccacgtgttcgaaggcaccgcgcgcgtgttcgagagccaggatgctgctgtg
aaaggcatcctcgccgatgaagtgaaagccggcgatgtggtggtgattcgctacgaaggc
cccaagggcggccccggcatgcaggaaatgctctaccccaccagttacctgaaatccaag
ggcctgggcaaacaatgcgccctgctcaccgacggccgcttctctggcggcacttcggga
ttatcgatcggccacgcctccccagaagccgccgcaggcggcgcgatcggcctggtgcgc
gacggcgacaagatcctgatcgacattcccaatcgtggaatcaacctgctgatttccgat
gaagcacttgccagccgccgcgccgagcaggatgccaaaggctggaagccggtcgaagtg
cgcccgcgcaaggtgaccactgcgttgaaagcgtatgcgttgctggccaccagtgcggat
aagggtgcggtgcgggataaggcgttgttggacggctga

DBGET integrated database retrieval system