KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_04935Help
Entry
AZ54_04935        CDS       T03765                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy00620  Pyruvate metabolism
xoy00680  Methane metabolism
xoy01100  Metabolic pathways
xoy01120  Microbial metabolism in diverse environments
xoy01200  Carbon metabolism
Module
xoy_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZ54_04935
  09102 Energy metabolism
   00680 Methane metabolism
    AZ54_04935
Enzymes [BR:xoy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZ54_04935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AJQ82054
LinkDB All DBs
Position
1014727..1017441
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLTGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERTSDAARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVLALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYTAPSELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDGQDATRRAAVLGPYACGQEALPRAQDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDAAGTVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVAAPEFMQYFRLSTPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMA
QDWPFFRTFLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGL
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggtgcactggtgggtgatctgctcgccgagcaggtgtctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgccccg
ccctccacgttgagcgaacaactcaccgggcgcgagccgcgtgatgccgaagcgctggtg
cgcgccttcagtacctatttccaggtcgtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgccgcgagtaccagcgcagcggtaccgacacgccgcagccggatggcctgcacgac
gcattgcgtcggctcaaggcgcagggcgtgacgctggacgaactcagccagtggttgccg
cgcatcgatgtggagccggtgttcaccgcgcatcccaccgaggcggtgcgccgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctagtcgacaacctggacggcatgcgcacg
cccaatgagcgcaccagcgatgcggcacgtttccgcatggcgttgaccgcttcgtggcag
accgccgattcctcgccggtgcgccccaccgtgggcgacgagcgcgagcatgtgggcttc
tatctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaaccctcgaacacgcc
atagaagaaacctatggcagcgtgctagccctgccgcgcctgctgcgtttcggcacctgg
gtgggcggcgacatggacggcaatcccaatgtggatgccaacaccatcgccggcaccctg
gatgcacaacggcgcgcggtgctggaccgctatcaaaaggaactctggcagctggccagc
ctgctcagtcaatcgaccacgctggtgcaggtgagcccggaactcatgacgcagctggaa
cgctatcgcgcgctgctgccggacgccgcggcacggtcgcgtccacgtcacggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcccgcctgcaggccacactggacgatgcc
gacggcgcctataccgccccctctgaactcgaagacgatctgcagttgatcctggacagc
ctgcaggccaacaagggcctgcacgccggttggttcgccgtgcggcgtctgctgtggcgt
gtgcgcagtttcggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcggtggccgatgctttgggccagaccgactgggacgggcaggacgcaacccgg
cgcgccgccgtgctcggcccgtatgcctgcgggcaagaagccttgccgcgcgcgcaggat
gaaggcaatgcgcggctggacgcggtattcgccgcgctcgccgatgcacgcacgcgccac
ggtgccgatgcactgggcagctacatcatttcgatggcgcacaaccgcgccgacgtgctc
actgtgctggcgctggcgcgccgcggcggattggtcgacgccgccggcaccgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggcaccggcacggtgcag
gacctgctggccgacccggtgtatcgccagcatctggccgcgcgcggcgatacgcagatg
gtgatgttggggtattcggatagcggcaaggacggcggcatcgccgcctcgcgctggggg
ctgcagcgtgcgcaggtggaactgctggaagccgctgccgatctgggcgtgcggctgacc
ttcttccacggccgtggcggttcgatcgcgcgcggtggcggcaagaccagccgcgcgctg
gacgccgccccgcgcggcagcgtcgatggccgcctgcgcgtcaccgagcagggcgaggtg
atccaccgcaagtacggcatccgtgcattggccttgcgctcgctggagcagatgaccggc
gcggtgttgctttcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgctggcgt
ccggtgatggatctggtggccgaacgcagcaccgtcgcctatcgcgccttcgtcgccgcg
ccggagttcatgcagtacttccgcctgtccacgccgatcgatgtgatcgaacgcatgacg
ctgggctcgcggccctcgcggcggctggggcaggacgcggcgttgtccaacctgcgtgcg
attccgtgggtgttcgcctggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagacaccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgatgtcgccatggtgctgtccaagggc
gatctgaatatcgccgagttgttttcgcgcttgtccggcgacttgcacacgcggtttttc
ccgctgattcgcgacgaactggccttgaccaagggctgggtcaaggcactgctgcagcag
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaacccgtac
atcgacccgatcagcgtgctgcaggtagacctgctgcagcgctggcgcgctaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaacggcgtctcgcaaggtttg
cagaacactggttga

DBGET integrated database retrieval system