KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_05250Help
Entry
AZ54_05250        CDS       T03765                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy00010  Glycolysis / Gluconeogenesis
xoy00053  Ascorbate and aldarate metabolism
xoy00071  Fatty acid degradation
xoy00280  Valine, leucine and isoleucine degradation
xoy00310  Lysine degradation
xoy00330  Arginine and proline metabolism
xoy00340  Histidine metabolism
xoy00380  Tryptophan metabolism
xoy00410  beta-Alanine metabolism
xoy00561  Glycerolipid metabolism
xoy00620  Pyruvate metabolism
xoy00625  Chloroalkane and chloroalkene degradation
xoy00903  Limonene and pinene degradation
xoy01100  Metabolic pathways
xoy01110  Biosynthesis of secondary metabolites
xoy01120  Microbial metabolism in diverse environments
xoy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZ54_05250
   00053 Ascorbate and aldarate metabolism
    AZ54_05250
   00620 Pyruvate metabolism
    AZ54_05250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZ54_05250
   00561 Glycerolipid metabolism
    AZ54_05250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZ54_05250
   00310 Lysine degradation
    AZ54_05250
   00330 Arginine and proline metabolism
    AZ54_05250
   00340 Histidine metabolism
    AZ54_05250
   00380 Tryptophan metabolism
    AZ54_05250
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZ54_05250
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZ54_05250
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZ54_05250
Enzymes [BR:xoy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AZ54_05250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJQ82108
LinkDB All DBs
Position
complement(1077501..1078970)
Genome map
AA seq 489 aa AA seqDB search
MEAVSETLRGIAARGPLGLFIDGQWRASTGDRHVDVIAQHTQESLLRYTEPSHADTEAAI
AAARNAFDNGPWPQLSPQERSMLLKRVAEQLRARMPELAEAWTGQVDATIGFSKRASQQA
PNLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWKAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVGEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARVGLKLGGKSAAIVLEDADSAKVLPTLVPYSMPIAGQVCFSLT
RMLVPAQRRDEILQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVRSYIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEFTPDMTIARGEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMRVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgtatccgaaacgctgcgcgggatcgccgcgcgtggtcctctgggcttgttc
atcgatggacaatggcgcgcaagcacgggagatcgccatgtcgatgtgatcgcgcagcat
acccaagaatcgctgctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaacgcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcatgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcgacgccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccgaatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaaggcgccgctggtcttgctgtgctacaaggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggt
cgcgaggtgggcgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcgggtcggc
ctgaaactgggcggcaaatcggcggcgatcgtgctggaggatgccgacagcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcatgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtttgccgccgataccggcatgggaccgttggcgctg
ggccgccagctcgaacgcgtgcggtcctatattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaattcacaccggacatgaccattgcgcgcggggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcatcgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgcgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system