KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_05660
Entry
BE73_05660        CDS       T03868                                 

Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00860  Porphyrin and chlorophyll metabolism
xoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BE73_05660
Enzymes [BR:xoz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     BE73_05660
SSDB
Motif
Pfam: DBI_PRT
Other DBs
NCBI-ProteinID: AJQ86647
UniProt: A0A0C5UWW6
LinkDB
Position
1175146..1176192
AA seq 348 aa
MSNDWIFGACAVPDARMRSAALARQEQLTKPPGALGRLEQLAVQVAAWQRTEHPAVQRVW
IAVYAADHGVAAEGVSAFPQAVTGEMVRNFARGGAAIAVLARELGARLEVVNLGVVNDPG
DLSRVRRAWIAPSTANICEQPAMTATQLRDALAAGAHSIAQAKSCDTQLFVGGEMGIGNT
TAAAALGCALLSQFPQALAGAGSGLDAEGIAHKVTVITRALALHADASTPLERLRRLGGF
EIAALVGAYIAGAQAGIPVLVDGFIATAAALVASRLNPGVREWLLFGHRSQERGHAALLR
ALDAEPLLQLDLRLGEASGAAVAIPLLRSACALHNGMATFAEAGVSDA
NT seq 1047 nt   +upstreamnt  +downstreamnt
gtgagtaacgattggatctttggtgcctgcgccgtgccggacgcgcgcatgcgctctgct
gcgttggcccggcaggaacaactgaccaaaccgccgggcgcattgggccggctggaacaa
ctggccgtgcaagtggcggcctggcaacgtaccgaacatcctgcggtgcagcgggtctgg
attgcggtgtatgccgccgatcatggtgtggcggccgaaggcgtgtcggcatttccgcag
gcagtcaccggcgagatggtgcgcaatttcgcgcgcggcggcgcggctattgcggtcctg
gcgcgcgagctgggtgcgcggctggaagtggtgaatctgggggttgtcaacgaccccggc
gacttgtcgcgggtgcggcgtgcctggattgcgccgtccaccgccaatatctgcgagcag
cccgcgatgacggccacgcaactgcgcgatgcgctcgccgctggtgcccacagcattgcg
caggccaagagttgcgacacgcagctgtttgtcggcggcgaaatgggcattggcaacacc
accgccgctgcagcgctgggctgcgcgttgctctcgcagtttccgcaggcgctggctggc
gcaggcagcggcctggatgccgaaggcatcgcgcacaaggtcaccgtgatcacgcgtgcg
ctggccttacatgccgatgcctccaccccgctggagcgtctgcgccggctcggcggattt
gaaatcgcggcattggtcggcgcgtatatcgctggggcgcaggcgggcattccggtgttg
gtggatggcttcatcgccaccgccgcggcattggtggccagccgcctgaaccccggcgtg
cgcgagtggttgttgttcgggcaccgttcgcaggagcgcgggcatgcggcactgctgcgt
gcgctggatgcagagcccttgctgcaactggacctgcggctgggagaagccagcggcgcc
gcggtggcgattccgttgctgcgcagcgcctgcgcgttgcataacggcatggcgaccttc
gccgaagccggagtgtcggacgcatga

DBGET integrated database retrieval system