KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_08585Help
Entry
BE73_08585        CDS       T03868                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00380  Tryptophan metabolism
xoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BE73_08585
Enzymes [BR:xoz01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BE73_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJQ87151
UniProt: A0A0C5UYK2
LinkDB All DBs
Position
complement(1785869..1787140)
Genome map
AA seq 423 aa AA seqDB search
MTDLLSRAHADALDAADPLRSLRDAFVFPQHGDRDQTYLVGNSLGLQPRAARAMVDEVLD
QWGTLGVEGHFTGPTQWLTYHQLVRDALARVVGAQPGEVVAMNTLSVNLHLMMASFYRPT
HERGAILIEAGAFPSDRHAVESQLRLRGLDPATHLIEVEADEPNGTLSMAAIADAIAQHG
PRLALVLWPGIQYRTGQAFDLAEIVRLARAQGAAVGFDLAHAVGNIPLTLHDDGVDFAVW
CNYKYLNAGPGAVGGCFVHERHANSDLPRIAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLTLFDQAGMAALRAKSERLTGHLEQLIRARVPQVLQIVTPAEPMRRG
CQLSLRVAGGRAQGRSLFEHLHAAGVLGDWREPDVIRIAPVPLYNRFSDLHTFVGQVEAW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgctgtcccgcgcccatgccgatgccctggatgccgccgacccgctgcgc
agcctgcgcgatgccttcgtgttcccgcagcacggcgatcgagatcagacgtatctcgtc
ggtaactcgcttggcctgcagccgcgcgcggcgcgcgcaatggtggacgaagtgctcgat
cagtggggcacgctgggggtggaaggtcacttcaccggccccacccaatggctgacctat
caccagctggtacgcgatgcgctggcccgcgtggtcggcgcgcaacccggcgaggtggtg
gcgatgaacaccctcagcgtcaatctgcaccttatgatggcgagcttttatcgtcccacg
cacgaacgcggcgcgatcctgatcgaagccggcgcgtttccgtccgaccgtcacgcggtg
gaatcgcagctgcgcctgcgcgggctggacccggccacgcatctgatcgaagtggaggcc
gacgaacccaacggcacgttatcgatggccgccattgccgatgccatcgcgcagcatggt
ccgcgcctggcgttggtactgtggccgggcatccagtaccgcaccgggcaggccttcgac
ctggccgagatcgtgcgactggcgcgggcgcaaggcgcggcggtgggctttgatctggcg
catgcggtgggcaacatcccgctgaccctgcacgacgatggcgtggatttcgcagtgtgg
tgcaactacaaatatctcaacgccggccccggcgcggtgggcggttgcttcgtgcacgaa
cgtcatgccaacagcgatctgccgcgtatcgccggctggtggggacatgagcagcagacc
cgcttccgcatggacccgcagttcgtgccctcgcccggtgccgaaggctggcagctgagc
aatcccccggtgctggcactggcgccgctgcgcgcatcgctgacgttgttcgaccaggcc
ggcatggccgcgctacgcgccaaatccgaacgactcaccgggcatctggagcagttgatc
cgcgcgcgcgtgccgcaggtgctgcagatcgtcaccccggccgaaccgatgcgccgcggc
tgccagctgtcgttgcgggtggccggcggacgcgcgcaggggcgctcgctgttcgagcat
ctgcatgcagccggcgtgctcggcgactggcgcgaaccggacgtgatccgcattgcgccg
gtgccgctgtacaaccgcttcagcgatctgcacaccttcgtgggccaagtggaagcctgg
gcggctgcctga

DBGET integrated database retrieval system