KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_10000Help
Entry
BE73_10000        CDS       T03868                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xoz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BE73_10000
Enzymes [BR:xoz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BE73_10000
Transporters [BR:xoz02000]
 Other Transporters
  Pores ion channels [TC:1]
   BE73_10000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJQ87380
UniProt: A0A0C5UJV0
LinkDB All DBs
Position
2096638..2097336
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPLLVDGD
LVVAESGAILEYLTERYDTECALSPSLRPLDSPERLQFRYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKHIARAIVDKAMAGFVGPQLSLHLDWMEQSLQSGNWFAGERFTAADIQM
SFPVQAAAARGGGLEKYPRLRAFLQRVEARPAYQAALKKGGPFELMGSKPAK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgttcaccatctcaacaactcccgttcccagcgcgtgctgtggctgctggaa
gaactggcgctgccgtatcagatcgtgcgccacgagcgcgaccccaagaccatgttggca
ccaccggccttgcgtgcgatccatccactgggcaaatcgccgctgctggtcgatggcgat
ctggtggtggccgaatccggtgcgatcctggagtacctgaccgagcgctacgacaccgaa
tgtgcgctgtcgccgtcgctgcgtccgctggattcgcccgagcgcctgcagttccgctat
tggatgcattacgccgaaggctcggcgatgccgccgttgctgatgacgttgatcttcggt
cgcatccgcagtgcgccgatgccgttcttcgccaagcacatcgcacgtgcgatcgtggac
aaggcgatggctggcttcgttggtccgcaactgtcgttgcatctggactggatggaacag
tcgctgcagtccggcaactggtttgctggcgaacgctttaccgccgccgatatccagatg
agctttccggtacaggcggctgctgcacgcggcggcggtctggagaaatatccgcggctg
cgcgcgtttctgcaacgggtcgaagcgcgccctgcttatcaggctgcgctgaagaagggc
ggcccgttcgagttgatgggaagcaagccggcgaagtga

DBGET integrated database retrieval system