KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_11630
Entry
BE73_11630        CDS       T03868                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00230  Purine metabolism
xoz00240  Pyrimidine metabolism
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
Module
xoz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
xoz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
xoz_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BE73_11630
   00240 Pyrimidine metabolism
    BE73_11630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xoz04131]
    BE73_11630
Enzymes [BR:xoz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BE73_11630
Membrane trafficking [BR:xoz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BE73_11630
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-ProteinID: AJQ87656
UniProt: A0A0C5V051
LinkDB
Position
2456127..2456552
AA seq 141 aa
MALERTLSIIKPDAVAKNVIGQIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF
SALVEFMISGPVMIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD
SVENAANEVAYFFAATEVVSR
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcgctggagcgcaccctgtccatcatcaagcccgacgccgttgccaagaacgtcatc
ggtcaaatctacagtcgcttcgagaaggctggcctgaaggttgtggccgccaagtacaag
cagctgtcgcgccgcgaagccgaaggcttctacgccgtgcaccgcgagcgtccgttcttc
agtgcgctggtggaattcatgatctccggcccggtgatgatccaggcgctggaaggcgag
aacgccgttgccgcacaccgcgacctgctgggcgcgaccaatcccaaggacgctgcgccg
ggcaccatccgcgccgacttcgctgattcgatcgatgccaatgccgcccacggctcggat
tcggtcgagaacgccgcgaacgaagtcgcgtatttctttgccgcaaccgaagtggtctcg
cgctga

DBGET integrated database retrieval system