KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_14380Help
Entry
BE73_14380        CDS       T03868                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00230  Purine metabolism
xoz00240  Pyrimidine metabolism
xoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BE73_14380
   00240 Pyrimidine metabolism
    BE73_14380
Enzymes [BR:xoz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     BE73_14380
    3.2.2.-  
     BE73_14380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Motif
Other DBs
NCBI-ProteinID: AJQ88101
UniProt: A0A0C5V1D5
LinkDB All DBs
Position
complement(3005406..3006791)
Genome map
AA seq 461 aa AA seqDB search
MELSSTAARALPVVDARVYPRGGLDVLSKAEVARLRDASSGGMHELLRRCALAVLTSGSA
SDDPRAARDLYPDFDIQVNQQDRGIRIDLTNAPAMAFVDGEIIRGVAELLFAVVRDLAYM
AIELEAQRADLDTSEGITNAVFGQLRNARILQPLDPNLVVCWGGHSILRDEYLYTKQVGY
ELGLRGLDICTGCGPGAMKGPMKGATIAHAKQRKHSTRYIGVTEPGIIAAESPNPIVNHL
VIMPDIEKRLEAFVRIGHGILVFPGGVGTAEEILYLLGILLREENADLPFPLILTGPTIA
TPYFEQIDRFIRLTLGDAAASRYEIIVGDPVAVARRMAEGVHQVRAHRKDQKDSYYFNWS
VHIPLEYQQPFEPSHAAMAALDLHHGRPAPALAADLRRAFSGIVAGNVKEDGMRRIEQFG
PFEIHGDPEIMQALDDLLRGFVEQRRMKISGDYRPCYRVAT
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaactcagcagtacggcagcacgggcgctgccggtggtggatgcgcgggtctacccg
cgtggtggcctggatgtgttgtccaaggccgaagtggccaggctgcgtgatgcatccagc
ggtggcatgcatgagctgctgcgccgttgcgcgctggccgtgctgaccagcggcagcgca
tcggacgacccgcgcgccgcgcgcgatctctacccggatttcgacatccaggtgaaccag
caggatcgcggcatccgcatcgatctgaccaacgcgccggcgatggcgttcgtcgatggc
gagatcatccgcggtgtggccgagctgctgttcgccgtggtgcgcgatcttgcctacatg
gccatcgaactcgaagcgcaacgcgccgatctcgataccagcgaaggcatcaccaatgcc
gtgttcggtcagttgcgcaatgcgcgcatcctgcagccgttggacccgaatctggtcgtg
tgctggggagggcattccattttgcgcgacgaatacctgtacaccaagcaggtcggctat
gaactcggcctgcgtgggctggatatctgcaccggctgtggcccgggcgcgatgaagggc
cccatgaaaggtgccaccatcgcgcatgccaagcagcgcaaacacagcacccgctacatc
ggcgttaccgagccaggcatcatcgccgccgaatcgccgaacccgatcgtcaaccatctg
gtgatcatgccggacatcgagaagcgcctcgaagccttcgttcgcatcggtcacggcatt
ctggtgttcccgggcggcgtcggcactgcagaagaaattctctacctgctcggcatcctg
ttgcgcgaagaaaatgcagacctgccattcccgctgatcctcacaggcccgaccatcgcc
acgccgtacttcgagcagatcgaccgcttcatccgcctgacccttggcgatgcagctgcc
tcgcgctacgagatcatcgtcggcgacccggtcgccgtggcgcgccgcatggccgaaggg
gtccaccaggtgcgcgcgcaccgcaaggaccaaaaggactcgtactacttcaactggtcg
gtgcacattccgctcgagtaccagcagccgttcgagcccagccacgcggcgatggccgcg
ctggacctgcatcacggtcgcccggcaccagccctggccgccgacctgcgccgcgccttc
tccggcattgttgccggcaacgtgaaggaagacggcatgcgccgcatcgagcaattcggc
cccttcgaaatccacggcgatcccgagatcatgcaggccctggacgaccttctgcgtggc
ttcgtcgagcaacggcggatgaagatctcgggggactaccggccttgttatcgggtggcg
acctag

DBGET integrated database retrieval system