KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_15830
Entry
BE73_15830        CDS       T03868                                 

Definition
(GenBank) aldehyde oxidoreductase
  KO
K13483  xanthine dehydrogenase YagT iron-sulfur-binding subunit
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00230  Purine metabolism
xoz01100  Metabolic pathways
xoz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BE73_15830
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: AJQ88347
UniProt: A0A0C5V1P7
LinkDB
Position
complement(3341706..3342356)
AA seq 216 aa
MRDIKMTRREVLIAGTASAASVAATHSMAATAATALSQEQAVEPANASSQVAFDVNGKPV
TLTLDNRTTLLDALREHLHLTGTKKGCDHGQCGACTVIVDGQRMNACLSLAVMHEGAKVI
TIEGLGTPDKLHPMQAAFVKHDGYQCGYCTPGQICSAVAVLDEVKRGIPSHVTEDLTGKT
KLTTPELQERMSGNICRCGAYSNIVEAINDVAGDRA
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagagatatcaagatgacccgtcgcgaggtactgatcgcgggaacggcatccgcagcc
agcgttgccgcaacccactcgatggccgccactgccgcgactgccctgtcgcaggagcag
gcggtcgagccagccaatgcatccagccaggtcgccttcgacgtcaacggcaagccggta
acgctgaccctggataaccgcaccaccttgctggatgcgctgcgcgaacatctgcatctt
accggcaccaagaagggctgcgatcacggccaatgcggcgcatgcacggtcatcgtcgat
gggcaacgcatgaacgcgtgcctgtcgctggcggtgatgcatgaaggtgcaaaagtgatc
accatcgaagggctgggcacgccggacaagctgcatcccatgcaggctgcgttcgtcaaa
cacgatggctaccaatgcggctactgcacgcccggccagatctgctcggcagtggcagtg
ctggatgaagtgaaacgcggcattcccagccatgtcaccgaagacctcaccggcaagacc
aagctcaccacgcccgagctgcaggagcgcatgagcggcaacatctgtcgctgcggtgcg
tattccaacatcgttgaagccatcaacgatgttgcgggagaccgcgcatga

DBGET integrated database retrieval system