KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_16885
Entry
BE73_16885        CDS       T03868                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K08289  phosphoribosylglycinamide formyltransferase 2 [EC:2.1.2.2]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00230  Purine metabolism
xoz00670  One carbon pool by folate
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
Module
xoz_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BE73_16885
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BE73_16885
Enzymes [BR:xoz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     BE73_16885
SSDB
Motif
Pfam: ATP-grasp Dala_Dala_lig_C 2-Hacid_dh_C Epimerase CPSase_L_D2 ATP-grasp_3 RmlD_sub_bind ThiF Sacchrp_dh_NADP Shikimate_DH GIDA
Other DBs
NCBI-ProteinID: AJQ88531
UniProt: A0A0C5V2I6
LinkDB
Position
complement(3553818..3555020)
AA seq 400 aa
MTTLGTPLSPSATRVLLLGSGELGKEVAIELQRFGVEVIAADRYANAPAMQVAHRSHVLD
MLDSAALRALIASERPHVIVPEIEAIHTETLMALEREQGQKVIPAARAARLTMDREGIRR
LAAETLGLPTSPYRFVDTAADYREAIAAVGLPCVVKPVMSSSGKGQSTLRSEADIDAAWE
YAQTGGRAGAGRCIVEGFIDFDYEITLLTVRHAGGTSYCDPIGHWQQDGDYRESWQPQPM
SAAALRRSQEIAKAITDDLGGWGLFGVELFVKGDEVWFSEVSPRPHDTGLVTLVSQELSE
FALHARAILGLPVGAEDGGVIGQSGPSASCALLAHGNGVPVFDNVADALRDPDTALRLFG
KPRVDGHRRVGVTLARADSIDAAREKARVAAAALGIQLTA
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgaccacccttggcaccccgctgtcgccttccgccacccgcgtgctgctgctgggctct
ggtgagctgggcaaggaagtggcgattgaactgcagcgtttcggcgtggaagtgatcgcg
gccgaccgctacgccaatgcgccggcgatgcaggtggcgcatcgctcgcacgtgctggat
atgctcgactccgcagcgctgcgcgcgctgatcgccagcgagcggccgcatgtgatcgtg
ccggagatcgaagcgatccataccgaaaccctgatggcactggaacgcgagcagggccag
aaagtcatccccgctgcgcgtgccgcacgcctgaccatggaccgcgaaggcatccgtcgg
ctggctgccgaaacgctgggcctgccgacctcgccgtatcgcttcgtcgacaccgctgcc
gactaccgcgaggcgattgcggcagtgggcctgccgtgcgtggtcaagccggtgatgtcg
tcctcgggcaagggccagagcaccttgcgcagcgaagccgatatcgatgcggcgtgggag
tacgcgcagaccggagggcgtgccggcgccggccgctgcatcgtcgaaggctttatcgat
ttcgattacgaaatcaccttgctcaccgtgcgccatgccggtggcacctcgtactgcgat
cccatcggacattggcagcaggacggcgactatcgcgaaagctggcagccgcagccgatg
tcggccgctgcattgcgccgctcgcaggagatcgccaaggccatcaccgacgatctcggc
ggctggggcctgttcggcgtggaattgttcgtcaagggcgacgaagtgtggttcagcgaa
gtgtcgccgcgcccgcacgacaccggtctggtcacgctggtctcgcaggaactgagcgaa
ttcgcgctgcacgcccgcgccattcttggcctgccggtgggcgcagaagacggcggcgtg
atcggtcagagcggcccctccgcatcctgcgcgttgctggcgcacggcaatggcgtgccg
gtgttcgacaacgtggccgacgcgctacgcgatccggacaccgcattgcgcctgttcggt
aaaccccgcgtggatggtcatcgccgcgtcggtgtcaccctggcgcgcgcggacagcatc
gatgctgcgcgcgagaaggcgcgtgtggcggcggctgcgctggggatacaactgactgcc
tga

DBGET integrated database retrieval system