KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_17965
Entry
BE73_17965        CDS       T03868                                 

Definition
(GenBank) adenylyltransferase
  KO
K00955  bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00230  Purine metabolism
xoz00261  Monobactam biosynthesis
xoz00450  Selenocompound metabolism
xoz00920  Sulfur metabolism
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
xoz01120  Microbial metabolism in diverse environments
Module
xoz_M00176  Assimilatory sulfate reduction, sulfate => H2S
xoz_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BE73_17965
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BE73_17965
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BE73_17965
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BE73_17965
Enzymes [BR:xoz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     BE73_17965
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     BE73_17965
SSDB
Motif
Pfam: APS_kinase GTP_EFTU MMR_HSR1 AAA_33 AAA_18 RsgA_GTPase AAA_16 GTP_EFTU_D2 AAA_29 Zeta_toxin Thymidylate_kin FeoB_N ParA KTI12 AAA_10
Other DBs
NCBI-ProteinID: AJQ88726
UniProt: A0A0C5V343
LinkDB
Position
complement(3802124..3804037)
AA seq 637 aa
MDGSALANPHSPLPTPGTIGAYLQQHESKPLLRFITCGSVDDGKSTLIGRLLYDSKRLFD
DQLAALESDSRRHGTQGERIDYALLMDGLAAEREQGITIDVAYRYFDTDRRKFIVADCPG
HEQYTRNMATGASTADVAVVLVDARKGLLAQTRRHSYIVSLLGIGHVVLAVNKMDLVDYD
AQVFADIAQGYGALAAQLGIADVQCIPLSALAGENLSSASTRMPWYSGPHLLQHLDTVQL
EPPEAGSGLRVPVQWVNRPNAQFRGYAGTIAAGQVQVGDAVVVVPSGRRTQVARVLDANG
EVGSARAGQAVTLTLRDEIDISRGDIIAAVNDPPEVADQFAGHLLWMDDAALLPGRPYWL
KIGTRTVTASISEIKHKVDVNTQERLAAKRLELNEVGYCNLALHEPIAFSPYARNRVLGG
FILIDRQSNATVAAGTLEFALRRAGNVHWQHLDVDRSARARIKGQAPRVLWFTGLSGAGK
STVANLVDKRLHALGYHTFILDGDNVRHGLNRDLGFTDEDRVENIRRVAEVARLMADAGL
IVLVSFISPFRAERQLARERFDQGEFVEVFVDVPLAVAESRDVKGLYRKARAGQIPNFTG
IDSPYEAPETPEIHLHADGENVEALARHVLEYLGLER
NT seq 1914 nt   +upstreamnt  +downstreamnt
atcgacgggagcgctctggcgaatccccactccccactccccactcccggcaccattggt
gcctacctccagcagcacgaatccaagcccttactgcgcttcatcacctgcggtagcgtg
gacgatggcaagagcaccttgatcgggcggttgctgtacgacagcaagcgcttgttcgac
gatcagcttgcggcgctggaaagcgatagtcgccggcatggcacgcagggcgagcgcatc
gattacgcgttgctgatggatgggctggcggccgagcgggagcagggcatcaccatcgat
gtggcctaccgctatttcgataccgaccggcgcaaattcatcgtggccgattgccccggg
cacgagcagtacacgcgcaatatggccaccggtgcgtcgactgccgatgtggcggtggtg
ctggtggatgcgcgcaagggcttgttggcgcagacccgtcggcacagctatatcgtgtcg
ttgctcggcatcggccatgtggtgctggcggtcaacaagatggatctggtggactacgac
gcgcaggtgttcgccgacattgcacaaggctacggcgcgctcgccgcgcagctgggcatc
gccgatgtgcagtgcattccgctatcggcgctggcgggcgagaatctgtccagcgcttcg
actcggatgccttggtacagcggcccgcatctgctgcagcatctggacaccgtgcagctc
gaaccgccggaggccggtagcggcctgcgtgtgccggtgcagtgggtcaatcgccccaac
gcgcagttccgcggctatgcaggtacgatcgctgccggccaggtgcaggtgggcgatgca
gtagtggtggtgccgtccgggcgccgtacgcaggtggcacgcgtgctcgatgccaacggc
gaggtgggcagcgcacgcgccgggcaggcagtgacgctgaccttgcgcgatgagatcgac
atcagccgtggcgacatcatcgccgctgtcaacgatccgcccgaagtggccgaccagttc
gctgggcatctgctgtggatggacgatgccgcgctgctgcccgggcgcccgtattggctc
aagatcggcacccgcacggtcactgcaagcatcagcgagatcaagcacaaggtcgatgtg
aacacgcaggagcggctggccgccaaacggctggagcttaacgaagtgggttattgcaat
ctggcgctgcacgaacccatcgcgttctcgccgtacgcacgcaaccgcgtgctcggcggt
ttcatcctgatcgaccgccaaagcaatgccacggtggctgccggcacgctggaattcgcc
ttgcgccgcgccggcaacgtgcactggcaacatctggacgtggaccgcagcgcacgtgcg
cgcatcaagggccaggcgccgcgcgtgctgtggttcaccggcctgtcgggtgcaggcaag
tccaccgttgccaacctggtcgacaagcgcctgcacgccctgggctatcacaccttcatc
ctggacggcgacaacgtgcgccacgggctcaaccgcgatctgggcttcaccgacgaagat
cgcgtggagaatattcgccgcgtagcggaggtggcacgtttgatggccgatgccggcctg
atcgtgctggtgagtttcatttcgccgttccgtgccgagcggcagctggcacgtgagcgc
ttcgatcagggcgagtttgtcgaagtgttcgtggacgtgccgctggcggttgccgaatca
cgcgacgtgaaggggctgtaccgcaaggcgcgtgccgggcagattcccaatttcaccggc
atcgactcgccgtacgaggcgcccgaaacgccggagatccatcttcacgccgatggtgag
aatgtagaggcactggcgcgccacgtgctcgagtatttgggtctggaacgctaa

DBGET integrated database retrieval system