KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_19610Help
Entry
BE73_19610        CDS       T03868                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BE73_19610
Enzymes [BR:xoz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BE73_19610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Glutaredoxin Thi4 DAO FMO-like Thioredoxin_4 K_oxygenase Spermine_synth NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AJQ88999
UniProt: A0A0C5VF91
LinkDB All DBs
Position
4115339..4116931
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDDSPGSREMLELLEELVLLSDTISLDIHRDDTQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLEGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAARRDAAKIAAKEAFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRHYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADDVLQRKLRSLHNVHIITSAQTTEVLGDG
QKVTSLVYKDRTGGAIQHIDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAHAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtgacgcggccg
attcagatcaacgcctcgatcgacgacagccctggctcgcgcgaaatgctcgaactgctg
gaagagctggtgctgttgtcggacacgatcagcctggacatccaccgcgacgacacccag
cgcaagccctctttcgcgctgaccaccccgggccaggacatctcgctgcgcttcgccggg
ctgccgatgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggccat
ccgtccaaggcggctgccgagctgatcgagcaggtgcagcacctggaaggcgattaccag
ttcgaaacctatttctcgttgtcgtgccagaactgcccggacgtggtgcaggcactgaac
ctggccgccgtgctcaacccgcgcatcaagcacgtggccatcgacggtgcctggttccag
gacgaagtggaaacccgtcagatcatgtcggtgcccaccgtgtacttgaatggtgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctggataccaacgccgcc
aggcgcgacgctgcgaaaatcgccgcgaaagaggcgttcgacgtgctggtggtgggcggt
ggcccggccggtgcggcagcagcggtgtatgccgcacgcaagggcatccgtaccggcgtg
gccgccgaacgttttggtgggcaggtgctggacaccatgtcgatcgagaacttcatttcc
gtgccggaaaccgaaggcccgaagatggccgccgcgctcgagcaacacgtgcgccactac
gatgtggacatcatgaatctgcagcgtgccgagcagctgattccggccggtgccgatggc
ctgatcgaaatcaaactcgccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgcctggcgaggaccagtacaagaacaaggga
gttgcctactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgatgacgtgctgcaacgcaagctgcgc
agcctgcacaacgtgcacatcatcaccagcgcgcagaccaccgaagtgctcggcgacggg
cagaaggtgaccagcctggtctacaaggaccgcaccggtggcgctatccagcacatcgat
ctggaaggcgtattcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtagcgctgtcgccgcgcggcgagatcatcgtcgacgaccgcggccagaccgatgtgccg
ggcgttttcgccgccggcgacgctaccacggtgccctacaagcagatcgtgatcgcgatg
ggcgaagggtccaaggcggccctgagcgcattcgatcatctgatccgctccagcgcaccg
gccactgccgataacgtggcccacgccgcataa

DBGET integrated database retrieval system