KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_19725Help
Entry
BE73_19725        CDS       T03868                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00010  Glycolysis / Gluconeogenesis
xoz00053  Ascorbate and aldarate metabolism
xoz00071  Fatty acid degradation
xoz00280  Valine, leucine and isoleucine degradation
xoz00310  Lysine degradation
xoz00330  Arginine and proline metabolism
xoz00340  Histidine metabolism
xoz00380  Tryptophan metabolism
xoz00410  beta-Alanine metabolism
xoz00561  Glycerolipid metabolism
xoz00620  Pyruvate metabolism
xoz00625  Chloroalkane and chloroalkene degradation
xoz00903  Limonene and pinene degradation
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
xoz01120  Microbial metabolism in diverse environments
xoz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BE73_19725
   00053 Ascorbate and aldarate metabolism
    BE73_19725
   00620 Pyruvate metabolism
    BE73_19725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BE73_19725
   00561 Glycerolipid metabolism
    BE73_19725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BE73_19725
   00310 Lysine degradation
    BE73_19725
   00330 Arginine and proline metabolism
    BE73_19725
   00340 Histidine metabolism
    BE73_19725
   00380 Tryptophan metabolism
    BE73_19725
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BE73_19725
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BE73_19725
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BE73_19725
Enzymes [BR:xoz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BE73_19725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJQ89022
UniProt: A0A0C5V3M7
LinkDB All DBs
Position
4135782..4137251
Genome map
AA seq 489 aa AA seqDB search
MEALSETLRGIPARGPLGLFIDGQWRASTGDRHTDVIAPHTQEPLLRYTEPSHADTEAAI
AAARNAFDNGPWPQLSPQERSVLLKRVAEQLRARMPELAEAWTGQVGATIGFSKRASQQA
PDLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWNAPLILLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVGEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARIGLELGGKSAAIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRRDEILQAYCAALSAVKLGDPCAADTGMGPLALGRQLERVRSHIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEVTPDMTIAREEIFGPVVSFIDYHDEADLIAKANAGD
SGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSDIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttatccgaaacgctgcgcgggatccccgcgcgtggtcctctgggcttgttc
atcgacggacaatggcgcgcaagcacgggggatcgccataccgatgtgatcgcgccgcat
acccaagaaccgctgctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaacgcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcgtgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcggcgccaccatcggcttcagcaagcgggcgtcgcaacaggcg
ccggatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaacgcgccgctgatcttgctgtgctacaaggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggc
cgcgaggtgggcgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcggatcggc
ctggaactgggcggcaaatcggcggcgatcgtgctggaggatgccgacatcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcgtgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtgtgccgccgataccggcatgggaccgttggcgctg
ggccgccagctcgaacgcgtgcggtcccacattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaagtcacaccggacatgaccattgcgcgcgaggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tccggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcattgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgtgggtagacatcagcatgccgttc
ggcggcttcaagcactcggacatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system