KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_19830
Entry
BE73_19830        CDS       T03868                                 

Definition
(GenBank) bis(5'-nucleosyl)-tetraphosphatase
  KO
K01525  bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [EC:3.6.1.41]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00230  Purine metabolism
xoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BE73_19830
Enzymes [BR:xoz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.41  bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
     BE73_19830
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-ProteinID: AJQ89042
UniProt: A0A0C5V3P8
LinkDB
Position
4157516..4158472
AA seq 318 aa
MSVWAIGDLQGCYDITQRLLEKINFDPAQDTLWFCGDLVNRGGQSLETLRLVHSLRAHSV
VVLGNHDLSLLAIGARSEEEQRKVNPDLLRIVLAEDRDALLDWLRMQKLAHVDRELGWMM
IHAGLAPKWTTQMAEKHAREVEQQLQGGGYRKLLRNMYGDQPGWSPGLIGYDRSRAIINL
FTRMRYCTPRGRIATDDKGTPGTQAQGLYPWFEVPGRVERDLKIVCGHWSALGLTITQGV
HAIDTGAVWGGKLTALQLDTDELRVVQVPGREVTGPAPVARAPRRPRERLGRQRSRGNRG
NAGNTAVPAKPPVDTPQD
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagcgtctgggcaatcggcgacctgcaagggtgctatgacatcacccagcggttgctg
gaaaaaatcaatttcgatcccgcgcaggacacgctgtggttctgcggcgacctggtcaac
cgcggcgggcaatcgctggaaacgttgcgcctggtgcattcgttgcgcgcgcacagcgtg
gtggtgctgggcaatcacgacctgtcgctgctggcaatcggtgcgcgctcggaagaagag
cagcgcaaggtcaacccggatctgctgcgcatcgtgctggccgaggatcgcgacgccctg
ctcgactggctacgcatgcagaagctggcgcacgtggaccgcgaactgggctggatgatg
atccacgccgggttggcgccgaagtggaccacgcagatggccgagaagcacgcacgcgag
gtcgagcagcaactgcagggcggcggctatcgcaagctgctgcgcaatatgtacggcgat
cagccgggctggtcgccgggcctgatcggatacgatcgcagccgcgcgatcatcaatctg
ttcacccgcatgcgttattgcaccccacgcgggcgtatcgccaccgacgacaagggcacg
ccgggaacgcaggcgcagggcctgtatccgtggttcgaggtgccggggcgcgtcgagcgc
gatctgaagatcgtctgcgggcattggtctgcgctggggctgacgatcacccagggtgtg
catgcgatcgataccggcgcggtctggggcggcaagctcacggcgttgcagctggataca
gacgaattgcgcgttgtgcaggtccccggacgtgaagtgaccgggccggcaccggtcgca
cgcgcaccgcggcgtccacgtgagcgcctggggcgtcagcgttcgcgcggcaaccgcggc
aatgcggggaacactgcggtgccggcgaagccgccagtcgatacgccacaagactga

DBGET integrated database retrieval system