KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_20190Help
Entry
BE73_20190        CDS       T03868                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00550  Peptidoglycan biosynthesis
xoz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BE73_20190
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BE73_20190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xoz01011]
    BE73_20190
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xoz03036]
    BE73_20190
Enzymes [BR:xoz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BE73_20190
Peptidoglycan biosynthesis and degradation proteins [BR:xoz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BE73_20190
Chromosome and associated proteins [BR:xoz03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BE73_20190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer MttA_Hcf106
Motif
Other DBs
NCBI-ProteinID: AJQ89103
UniProt: A0A0C5V6T8
LinkDB All DBs
Position
complement(4236658..4238526)
Genome map
AA seq 622 aa AA seqDB search
MKTGRNRPRSNFNLRGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELP
IATLRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQK
ASKEFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEG
LELAFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRN
ALVENNAAGGAMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMK
PLTVATALTAGVVTKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKI
AAKVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQ
IAQAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETVVTQGGARGAAILGY
HVAGKTGTARKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKVYYGGLVSAPV
FHKVMEGALRLMDVPPDDIQSWLAAQAAGKTGQPMVKPQSADLDPALVPDPVDEVSAGIP
TALAPAPAAAPAQPAPLQESRQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccggccgtaaccgcccccgcagcaatttcaatctccgtggtcgcctgaccctg
gtcggcatcgccttgggcttgtgctcggtgacgttgatcgggcgcgccgcgttcgtgcag
ctggtcaaccgcgatttctatcagcgtcagggcgaagcgcgttacttgcgcgaactgcct
atcgccaccttgcgcggcatgatcaccgaccgcaacggcgagccgctggcggtgtccacg
ccggtggaatcgatctgggtcaatccgcaggaattgctgcgcaacccggaccgcattccc
gagctggccaaggcgctcggacagccgctggacgaattgaacgccaagctggcacagaag
gccagcaaggaattcatgtacttgcagcgccgcatcaatccggacaaggcgcatgcgatt
gtcgatctgaagattcccggcgtgttctcgcagcgcgagttccgtcgcttctatccgcaa
ggcgaagcgatggcccacgtgctgggcttcaccaacatcgacgaccgcgggcaggagggc
cttgaattggccttcgacgaatggctgcgcggcaagccaggttccaagaaggtggtgcgc
gatgcgcggggtgccatcgtggaaagcgtggacctggtgcgtccggcgcaaccgggcaag
gacctgacgctgagcatcgaccgccgcatccagttcctggcctacaaggaactgcgtaac
gccctggtcgaaaacaacgcagccggcggtgcgatggtggtgatggacgtggccactggc
gaagtgctggcgatggtcaacctgcccacctacaacccgaattcggtcaccggcatcaac
ccgtcggcgcgccgcaaccgcgcggtcaccgatctggtcgagccgggttcgacgatgaaa
ccgctgaccgtggccaccgcgctgactgccggcgtggtgaccaaggacaccgtcatcgat
accaaccccggctacatgtcggtggggcgcttcaccattcgcgatgtgccgcgcaacaac
ggcgtgctcaatgtcactggcgtgatcacccgcagctcgaacatcggtgcggccaagatc
gccgccaaggtgccggaccagaccttctatcagtcgatccgcaacttcggttacggcagt
gcgccgcatagcggatttcctggtgaatcggccggtgtggtgttgcagccggcacgctgg
agcggcccgtccaagaccacgatgtcgtatggctacggcctgtcggtgacgccgctgcag
attgcgcaggcgtacgccacgctgggcaacggcggcaagctcaccccgcccacattcgtg
cgcggccagcacaacgaaacccgtcaggtgatcacgccggaagtggcgcggcaggtcatc
gacatgatggaaaccgtggtcacccaaggcggcgccaggggcgcggcgatcctgggttat
cacgtcgccggcaagaccggtaccgcgcgcaagaacggcgccaacggctacgagcgcggg
cattacaacgcgctgttcgcgggtctggtacccgccacgcgcccgcgctttgccaccgtc
atcgtgatcaacgatccgcagggcaaggtgtactacggcggcctggtgtcggcgccggtg
ttccacaaggtgatggaaggcgcgctgcgcttgatggacgtgccgccggacgacatccag
tcatggttggccgcacaggctgccggcaagaccggccagcccatggtcaagccgcagtcg
gccgatctggatccggcgctggtgccggacccggtggacgaagtgtctgccggcatcccg
accgcactggcacctgcgccggccgccgcgccagcgcagcccgcgccgttgcaggagagc
cgccagtga

DBGET integrated database retrieval system