KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_22725Help
Entry
BE73_22725        CDS       T03868                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00473  D-Alanine metabolism
xoz00550  Peptidoglycan biosynthesis
xoz01100  Metabolic pathways
xoz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BE73_22725
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BE73_22725
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BE73_22725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xoz01011]
    BE73_22725
Enzymes [BR:xoz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BE73_22725
Peptidoglycan biosynthesis and degradation proteins [BR:xoz01011]
 Precursor biosynthesis
  Amino acid ligase
   BE73_22725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AJQ89509
UniProt: A0A0C5VGR7
LinkDB All DBs
Structure
PDB: 

Position
4772839..4773942
Genome map
AA seq 367 aa AA seqDB search
MRTIRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDKQGQWHVNDPDSFLLH
ADDPARIALHRSGRGVALLPGAQQQQLRPIQPEQALAQIDVVFPIVHGTLGEDGSLQGLL
RMANLPFVGSGVLGSAVAMDKDMAKRVLRDAGLAVAPFVCVDRHTAAHADVDTLIAQLGL
PLFVKPANQGSSVGVSQVRTADAFAAALALALAYDHKVLVEAAVAGREIECAVLGNAVPH
ASVCGEVVVHDAFYSYATKYISEHGAEIVIPADIDAQTQQRIQQIAVRAYQALGCAGMAR
VDVFLCADGRIVINEVNTLPGFTRISMYPKLWQASGLDYRGLITRLIELALERHADDQLL
RSAVELH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgattcgggtcggcctcatcttcggcggcaaatcggccgagcacgaggtttcg
ttgcaatcggcgcgcaacatcctggatgcgctggacccgcaacgcttcgagccggtgctg
attggtatcgacaagcaaggccaatggcacgtcaacgaccccgacagcttcctgctccat
gccgacgacccggcacgtattgcgctgcatcgcagtggtcgcggggtggcactgctgccg
ggcgcgcaacagcagcaattgcggcccatccagccggagcaggcgctggcgcaaatcgat
gtggtgttccccatcgtgcacggcaccttgggcgaagacggctcgctgcaggggctgctg
cgcatggccaacctgcccttcgtgggctccggcgtgctgggctcggcggtggcgatggac
aaggacatggccaagcgcgtgttgcgcgatgccgggctggcggtggcaccgttcgtctgc
gtcgaccgccacaccgccgcgcacgccgatgtggatacgttgatcgcgcagctgggcttg
ccgttgttcgtcaaaccggccaaccagggctcatcggtcggcgtcagccaggtgcgcacg
gccgacgcattcgctgctgcactcgccttggcgttggcctatgaccataaggtgctggtg
gaagcggccgttgccgggcgcgaaatcgaatgcgccgtgctgggcaatgccgtgccacac
gcaagcgtctgcggcgaagtggtggtgcacgacgcattctattcgtacgcaaccaaatac
atcagcgaacacggtgccgagatcgtgattccggccgacatcgatgcgcagacccagcaa
cgcatccagcagatcgcagtgcgggcctaccaggcgctgggctgcgcaggcatggcgcgc
gtggacgtctttttgtgcgccgatgggcgcatcgtgatcaacgaggtcaacacgctgcca
ggtttcacccgcatcagcatgtatccgaaattatggcaggcaagcgggctggactatcgc
ggtctgattacgcggttgatcgagcttgcactggaacggcacgcagacgaccaactgctg
cgcagcgcggtcgagctacactga

DBGET integrated database retrieval system