KEGG   Xanthomonas perforans: BJD13_05335Help
Entry
BJD13_05335       CDS       T04778                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00020  Citrate cycle (TCA cycle)
xpe00190  Oxidative phosphorylation
xpe00650  Butanoate metabolism
xpe01100  Metabolic pathways
xpe01110  Biosynthesis of secondary metabolites
xpe01120  Microbial metabolism in diverse environments
xpe01130  Biosynthesis of antibiotics
xpe01200  Carbon metabolism
Module
xpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xpe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJD13_05335
   00650 Butanoate metabolism
    BJD13_05335
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJD13_05335
Enzymes [BR:xpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJD13_05335
    1.3.5.4  fumarate reductase (quinol)
     BJD13_05335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: APO98566
UniProt: A0A0G8Z4G7
LinkDB All DBs
Position
839375..840157
Genome map
AA seq 260 aa AA seqDB search
MAEFTLPKNSKIGKGKHYPAKGAKNTRTFKVYRWDPDVDANPRTDSYEIDLDKCGPMVLD
ALIKIKNEIDPTLAFRRSCREGICGSCAMNIDGTNTLACTKAIAACGKSEVPIYPLPHMS
VIKDLVPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPEDRRKLDGLYECILCACCSTS
CPSYWWNGERYLGPAILLQAYRWIIDSRDEDTGARLDDLEDPFKLYRCHTIMNCARTCPK
GLNPALAIAEIKKLMMARRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttcaccctccccaagaattcaaagatcggcaagggcaagcattaccctgca
aagggcgccaagaacacgcgcaccttcaaggtctaccgctgggatccggacgtcgacgcc
aacccgcgcaccgacagttacgagatcgatctggataaatgcggcccgatggtcctggac
gcgctgatcaagatcaagaacgagatcgacccgacgctggcgttccgtcgctcctgccgc
gagggcatttgcggctcgtgcgcgatgaacatcgatggcaccaacacgctggcctgcacc
aaggcgattgccgcatgcggcaagtccgaggtgccgatctatccgctgccgcacatgagc
gtgatcaaggacctggtgccggatctgacgcatttctatgcgcagtacgcgtcgatcaag
ccgtggatccgtacccagaccccgccgccgccggaccgcgagcgcctgcagtcgccggaa
gaccgtcgcaagctcgacggattgtacgagtgcatcctgtgcgcatgctgctcgaccagt
tgcccaagctactggtggaatggcgagcggtatctgggcccggcgatcctgctgcaggcc
taccgttggatcatcgattcgcgcgacgaagacaccggtgcgcgtctggacgatctggaa
gacccgttcaagctgtatcgctgccacaccatcatgaactgcgcacggacctgcccgaag
ggcttgaacccggcgctggcgatcgccgaaatcaagaagctgatgatggcgcgtcgcgcc
tga

DBGET integrated database retrieval system