KEGG   Xanthomonas perforans: BJD13_12385Help
Entry
BJD13_12385       CDS       T04778                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00010  Glycolysis / Gluconeogenesis
xpe00053  Ascorbate and aldarate metabolism
xpe00071  Fatty acid degradation
xpe00280  Valine, leucine and isoleucine degradation
xpe00310  Lysine degradation
xpe00330  Arginine and proline metabolism
xpe00340  Histidine metabolism
xpe00380  Tryptophan metabolism
xpe00410  beta-Alanine metabolism
xpe00561  Glycerolipid metabolism
xpe00620  Pyruvate metabolism
xpe00625  Chloroalkane and chloroalkene degradation
xpe00903  Limonene and pinene degradation
xpe01100  Metabolic pathways
xpe01110  Biosynthesis of secondary metabolites
xpe01120  Microbial metabolism in diverse environments
xpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJD13_12385
   00053 Ascorbate and aldarate metabolism
    BJD13_12385
   00620 Pyruvate metabolism
    BJD13_12385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJD13_12385
   00561 Glycerolipid metabolism
    BJD13_12385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJD13_12385
   00310 Lysine degradation
    BJD13_12385
   00330 Arginine and proline metabolism
    BJD13_12385
   00340 Histidine metabolism
    BJD13_12385
   00380 Tryptophan metabolism
    BJD13_12385
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJD13_12385
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJD13_12385
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJD13_12385
Enzymes [BR:xpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BJD13_12385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APO99782
UniProt: A0A0G9EFA1
LinkDB All DBs
Position
2388831..2390300
Genome map
AA seq 489 aa AA seqDB search
MEALFETLRGIAARGPLGLFIDGQWRASTGDRSVDVIAPHTEERLLRYTEPSHADTEAAI
AAARRAFDHGPWPQLSPQARSVALKRVADHLRARMPELAEAWTGQVGATLGFSKRASQQA
PDLFDYYADLIATHAFVEPRVRPNGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKVSFTG
STQAGRSIGIACAERLARVGLELGGKSAAIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRREEVLQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVQSYIAKGKAQGAR
LAMGGGRPAHLSRGFFVEPTVFAEVTPDMTIAREEIFGPVVSFIDYHDEADLIAKANASD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTLYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttattcgaaacgctgcgcggcatcgccgcgcgaggtcccctgggtctgttc
atcgacgggcaatggcgcgcaagcaccggcgatcgctcggtcgatgtgatcgcgccgcat
accgaagaacggctgctgcgctacaccgaaccctcgcacgcagataccgaagcggccatc
gcagctgcacgccgcgccttcgaccacggcccctggccgcagctctccccgcaagcgcgc
agcgtggcactcaagcgggtggccgaccacttgcgtgcacgcatgccggagttggccgaa
gcatggacgggccaggtcggcgcgacccttggcttcagcaagcgcgcctcgcagcaggcg
ccggatttattcgactactacgccgacctgattgccacccacgcattcgtcgaaccacgt
gtgcgccccaacggtggccgcgtgcatgtggtgcaggagccggtcggcgtggtcgccgcg
atcacgccctggaacgcgccgctggtattgctgtgctacaaggtcgccgccgcgctggct
gccggctgcacggtggtggccaagccctcgccggaaacgccgatcgatgcctatatcctg
gccgagtgcatcagcgccgccggcgtgcccgatggcgtgttcaacctgctccccgccggc
cgcgaggtgggcgagcaattgatccgccacccgcacgtggacaaggtcagcttcaccggc
tccacccaggccggccgctcgatcggcatcgcctgcgccgagcgcctggcacgggttggg
ctggagctgggcggcaaatcggcagcaatcgtgctggaggacgccgacatcgccaaggtg
ctgcccaccctggtgccctactccatgccgatcgccggacaggtgtgcttctcgttgacg
cgcgtcctggtgccggcgcagcgccgcgaagaagtcctgcaggcatattgcgcggcactg
agcgcagtgaagctgggcgacccgtttgcggcagacaccgggatgggcccgttggccctg
ggccgccagctcgagcgtgtgcagtcctacatcgccaaaggcaaggcgcagggcgcacgc
ctggccatggggggaggccgcccggcacacctgtcgcgcggcttcttcgtcgaaccgacg
gtgtttgccgaggtgacgccggacatgaccattgcgcgcgaggaaatcttcggaccggtg
gtgagcttcatcgactaccacgacgaagccgacctcatcgccaaggccaatgccagcgac
tacggtctgcacggcaccatctacagcgaagacgccgaacgcgcctatcgcatcgcgcgc
cgcgtgcgcagcggcagtcatgcgatcaacggcatgtgggtcgatatcagcatgccgttt
ggtggcttcaagcattcgggtatcggccgcgaaggcggtatcgaaggtctgcatgccttc
ctcgaaaccaaaaccctctacctgagctag

DBGET integrated database retrieval system