KEGG   Xanthomonas perforans: BJD13_15145Help
Entry
BJD13_15145       CDS       T04778                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00564  Glycerophospholipid metabolism
xpe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJD13_15145
Enzymes [BR:xpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BJD13_15145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APP00243
UniProt: A0A0G9BCJ8
LinkDB All DBs
Position
2993576..2995090
Genome map
AA seq 504 aa AA seqDB search
MGEIYDLLVIGGGINGVGIARDAAGRGLSVCLCEQDDLAAHTSSASTKLIHGGLRYLEQY
EFALVGKALAEREVLLRLAPHIIWPLRFLLPHQPHLRPAWMIRAGLFLYDHLGGSKRSLP
RSRRLSLRTHPVGAPLQESLRTGFVYSDAWVQDARLVVLNAMDAARRGAKIHTRTRCVGA
WRDAGFWYAELEDREGRRRTVQARALANAAGPWAVAFLDTVASVPHEHALRLVKGSHIVV
PKLFDHDHAYIFQQPDRRIVFAIPYEHDFTLIGTTDVDYEADPAAPKIDAAEVQYLCDAV
NLYFQQQISPADVVWNYSGVRPLLDDAEDNAAEVTRDYQLEVVTEGAPLLNVFGGKLTTY
RKLAEEAVDRLTHALGARKPAWTAHGEALPGGEQRDIASLLERVGRARPWLPAATAQRLV
RNYGTCAEQLLGDAQSLADLGTHFGADLYQAEVDYLRQHEWAVAADDILWRRSKLGLRID
AAGRQRLEDYLQTQPIRQRDAVSA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatatacgatcttctggtaatcggcggcggcatcaacggggtcggcattgcc
cgtgatgcggccgggcgcggtctgtcggtgtgcctgtgcgagcaggacgacctggccgcg
cataccagcagcgccagtaccaaactcattcacggcggcctgcgctatctggagcaatac
gaattcgcgctggtcggcaaggcactggccgagcgcgaagtgttgctgcggctggccccg
cacatcatctggccgttgcgcttcctgctgccccaccaaccgcacctgcgcccggcatgg
atgatccgcgccgggctgttcctgtacgaccatctgggcggcagcaagcgcagcctgccg
cgctcgcggcggctgtcgctgcggacgcacccggtcggtgcgccgctgcaggaatcgctg
cgcaccggcttcgtgtattcggatgcctgggtgcaggacgcgcggctggtggtgctcaac
gcgatggacgccgccaggcgcggcgccaagatccacacccgcacgcgctgtgtcggcgcc
tggcgcgatgccggcttctggtatgccgagctcgaagaccgcgagggccgacgccgcacg
gtgcaggcgcgcgcgctcgccaatgcggccggcccctgggcagtggcgttcctggacacc
gtggcctcggtgccgcacgaacacgcattgcggctggtcaagggcagccatatcgtggtg
cccaagctgttcgatcacgaccatgcgtacatcttccagcaaccggaccggcgcatcgtg
ttcgccatcccctacgagcacgacttcaccttgatcggcaccaccgacgtggactacgaa
gccgaccccgccgcgccgaagatcgatgctgccgaggtgcagtacctgtgcgatgcggtg
aacctgtatttccagcagcagatctcccccgccgatgtggtgtggaattacagtggcgtg
cgcccgttgctggacgatgccgaagacaacgcagccgaagtgacccgcgattaccagctg
gaagtggtcaccgagggtgcgccgttgctcaacgtattcggcggcaagctgaccacctat
cgcaagctcgccgaagaggcagtggaccggctcacccacgcgctgggcgcacgcaagccg
gcgtggaccgcacatggggaggcattaccaggcggcgagcagcgcgatatcgccagcctg
ctggaacgcgtcggccgcgcgcgcccctggctgccggcggcgactgcgcagcggctggtg
cgcaactacggcacctgcgccgaacaactgcttggcgatgcgcagagcctggccgatctg
ggcacgcacttcggtgcggacctgtaccaggccgaggtggattacctgcgtcaacatgaa
tgggcggtggctgccgacgatatcctgtggcggcgcagcaagctcggcctgcggatcgat
gcggccgggcggcagcgcctggaagactatctgcagacgcagccgatccggcaacgcgat
gccgtttctgcttga

DBGET integrated database retrieval system