KEGG   Xanthomonas perforans: BJD13_16455Help
Entry
BJD13_16455       CDS       T04778                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00010  Glycolysis / Gluconeogenesis
xpe00620  Pyruvate metabolism
xpe01100  Metabolic pathways
xpe01110  Biosynthesis of secondary metabolites
xpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJD13_16455
   00620 Pyruvate metabolism
    BJD13_16455
Enzymes [BR:xpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BJD13_16455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: APP00464
UniProt: A0A0G8ZS30
LinkDB All DBs
Position
complement(3273494..3275023)
Genome map
AA seq 509 aa AA seqDB search
MNAQPATKPLNTDPQSIFKPRYDNFIGGKWVAPKDGQYFDNTTPINGKVFTSIARSTAPD
IEAALDAAHAAKEAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDRFMEKALARVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAQVLIGGERNTLEGDLAGGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGLWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGLF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcaacctgccaccaagccgctcaacaccgatccgcagtcgatcttcaaaccg
cgctacgacaacttcatcggcggcaagtgggtcgcgccgaaggatggtcagtatttcgac
aacaccacgccgatcaacggcaaggtctttacctcgatcgcgcgctccaccgctccggat
atcgaagcggcgctggatgctgcgcacgcggccaaggaggcgtggggcaagacctccacc
accgagcgctctaacgtactgctcaagatcgccgaccgcatcgaacagaatctcgaactg
ctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgccgac
gtgccattgtgcgtggaccacttccgctatttcgccggtgccatccgcgcgcaggaaggc
ggtatttccgagatcgacagcgacaccatcgcgtatcacttccacgaaccgttgggcgtg
gtggggcagatcattccgtggaatttcccgctgctgatggcgtgctggaaactcgcgccg
gcgcttgccgccggcaactgcgtggtgatgaagccggcagagcagacgccggcttcgatt
ttggtgttgatggaactcatcggcgacctgctgccgcctggcgtgttgaacgtggtcaac
ggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagattgcg
ttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggtggcaaatcgcccaacatcttcttcgccgatgtgatggcc
gaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgccttcaatcaa
ggcgaagtgtgtacctgcccgtcgcgcgcgctgatccaggaatccatctacgacaggttc
atggaaaaggcgcttgcgcgcgtggcggcgatcaagcagggcaatccgctcgatcccaac
accatggtcggtgcgcaggcgtccagtgagcagctggaaaaaattctctcctacatcgat
atcggcaagcaggaaggtgcgcaagtgctgatcggcggcgagcgcaacacgctcgagggc
gacctggccgggggcttttacgtcaagcccacggtgttcaaggggcacaacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgaagcc
gacgcgctggcgatcgccaacgacacgctatacggcctgggtgccggcctctggagtcgc
gacgcttcgcgcctgtatcggatgggccgcgcgatccaggctggccgcgtgtggaccaac
tgctatcacgcctacccggcgcatgctgcatttggcgggtacaagcagtcgggcatcggc
cgcgaaaaccacaagatgatgctcgaccactatcaacagaccaagaacctgttggtgagc
tattcgccgaaggcgctggggcttttctaa

DBGET integrated database retrieval system