KEGG   Xanthomonas phaseoli: XppCFBP6546_03145Help
Entry
XppCFBP6546_03145 CDS       T05156                                 

Gene name
XppCFBP6546P_03145
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
xph  Xanthomonas phaseoli
Pathway
xph00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XppCFBP6546_03145 (XppCFBP6546P_03145)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xph01003]
    XppCFBP6546_03145 (XppCFBP6546P_03145)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xph01011]
    XppCFBP6546_03145 (XppCFBP6546P_03145)
Enzymes [BR:xph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     XppCFBP6546_03145 (XppCFBP6546P_03145)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XppCFBP6546_03145 (XppCFBP6546P_03145)
Glycosyltransferases [BR:xph01003]
 Polysaccharide
  Bacterial polysaccharide
   XppCFBP6546_03145 (XppCFBP6546P_03145)
Peptidoglycan biosynthesis and degradation proteins [BR:xph01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   XppCFBP6546_03145 (XppCFBP6546P_03145)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ATS28980
UniProt: A0A0A6U7D7
LinkDB All DBs
Position
complement(690111..692555)
Genome map
AA seq 814 aa AA seqDB search
MPRRHDNDAPDDFEDDTNAQGSRWQRRLIVWGFAAFALALGFLIPYTMYLNKQVTQRFGE
LRWQIPTRVYGRPLVLVPGNALDAATLKTELDAASYRDDGQATLAGTYQQDGSRFTIASR
GYIDVDGRVPARRIEVSLAGGRVASLRDAGDRKALKSARLDPARIATLYGQKQEERRLVR
MEEVPELLVTGLQAVEDRDFNSHHGIDLSGMVRAAWIMARSGGQVRQGASTLTQQLARSG
LLGIGKEQTLTRKFNEILYAVIMEARYDKRTILEAYLNQVYLGQRGGQAIHGVSSGAELW
FGRDLNSMTTEQIALLIGLVKGPSYYDPRRNPERALDRRNFVLGKLHENNLINDAEYKRA
LAAPLGVPTEPGLVAANRFPAYVDLVRRQLAHDYPEGVLQGAGMSVLTGMSPSAQAYAEG
AVTGTIKRLDNKKRPPLQAGLVLTDVHNGDVLAVVGSRDVAKPGFNRAVEAQRQVGSLLK
PFVYMLALASPDRWALSSWVDDSPVTVQLSRGKTWSPGNSDSRSHGTVRLVDALAHSYNQ
ATVRVGMQVGADRIAQLIQVLAGIKADSNPSLILGATDQSPYGMAQLYQFLAAGGEIQPL
HAVRGVLDPQGKLLKRYDKTPAPAQEGDSVAANLISIGLQQVVSNGTARQLLGDGLGRLS
PAGKTGTSNDGRDSWYAGYTGDHLAVIWMGNDQNAETGLYGATGAMRVWSSIFARLPSAP
LKVSGKGLDWQWVDASGTGVTDPGCPGARQFPFVVGFTPAYAPCAGNALSIEAAPGEAAA
PAEQSSGGGWRRFFGLEKKPEDPAAAPAAAPPTR
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgacgccacgacaacgacgctcccgacgatttcgaggacgacaccaacgcgcaa
ggctcccgctggcaacgcagactcatcgtctggggatttgccgcgttcgcgctggcgctc
ggtttcctgattccctacacgatgtatctgaacaagcaggtcacccagcgcttcggcgaa
ctgcgttggcagatcccgacccgcgtgtacggccggccgctggtgctcgtgccgggcaac
gcactggatgcggccaccctgaagaccgaactggacgcggcgtcgtaccgcgacgacggt
caggcgacgctggccggcacctaccagcaggacggtagccgcttcaccatcgccagccgc
ggctacatcgatgtggatggacgcgtgccggcgcgccgtatcgaagtcagcctggccggt
gggcgcgtggccagcctgcgcgacgccggcgaccgcaaggcgctcaaaagcgcacgcctg
gacccggcgcgcatcgccaccctgtacggccagaagcaggaagagcgccgcctggtgcgc
atggaagaggtgcccgaactgctggtcaccggcctgcaggcggtggaagaccgcgacttc
aatagccaccacggcatcgatctcagcggcatggtgcgtgcggcctggatcatggcgcgc
tccggcggccaggtccgccagggcgccagtaccctgacccagcagttggcccgcagcggc
ctgctcggcatcggcaaggaacagacgctcacgcgcaagttcaacgagattctgtacgcg
gtgatcatggaggcgcgctacgacaagcgcaccatcctggaggcctatctcaaccaggtg
tatctgggccagcgcggcggccaggcgatccacggcgtgtcctcgggcgcagagctgtgg
ttcggccgcgacctcaattcgatgaccaccgagcagatcgcattgttgatcgggctggtc
aaggggccgtcgtactacgacccgcggcgcaacccggaacgcgcgctggaccggcgcaat
ttcgtgctcggcaagttgcacgaaaacaatctgatcaacgacgccgaatacaagcgcgcg
ctggctgcgccgttgggcgtgccgaccgagcccggcctggtcgccgccaaccgcttcccg
gcctatgtggacctggtgcggcgccagctggcgcacgactatccggaaggcgtgctgcag
ggcgccggcatgagcgtgctcaccggcatgtcgccgtcggcgcaggcgtatgccgaaggc
gcagtgaccggcaccatcaagcggctggacaacaagaagcgtccgccgctgcaggcggga
ttggtgctcaccgacgtgcataacggcgatgtgctggccgtggtcggcagccgcgatgtc
gccaagccgggcttcaatcgtgcggtggaagcgcagcggcaggtgggctcgttgctcaag
ccgttcgtttacatgctggccttggcctcgccggaccgctgggcgctgtccagctgggtc
gacgactcgccggtcacggtgcagctcagccgcggcaagacctggtcgccgggcaattcg
gacagccgcagccatggcacggtgcggctggtggatgcgctggcgcattcctacaaccag
gccacggtgcgggtgggcatgcaggtcggcgccgatcgtatcgcccagttgatccaggtg
ctggccggcatcaaggccgactcgaatccgtcgctgatcctgggcgcgaccgaccagagc
ccgtacggcatggcgcagctctaccagttcctggcggccggcggcgagatccagccactg
catgcggtgcgcggcgtgctcgatccgcagggcaagctgctcaagcgttacgacaagacc
ccggcaccggcgcaggagggcgattcggtggccgccaacctcatcagcatcggtctgcag
caggtagtcagcaacggcaccgcgcgacagctgctgggcgatggcctgggtcgcctgtcg
ccggccggcaagaccggtacctccaacgacggtcgcgacagctggtatgccggctacacc
ggcgaccatctggcggtgatctggatgggaaacgaccagaacgccgaaaccggcctgtat
ggcgccaccggcgcgatgcgggtgtggtcgagcatcttcgcccgcttgccgagtgcgcca
ttgaaggtcagcggcaaaggcctggattggcagtgggtggacgccagcggcaccggcgtg
accgacccggggtgcccgggcgcgcgccagttcccgttcgtggtcggcttcacgccggcc
tacgcaccgtgcgcgggcaacgcgctgtcgatcgaggccgcgcccggcgaagcggccgca
cctgccgaacaatccagcggcggtggctggcgccgcttcttcggtctggaaaagaagccc
gaagaccctgccgccgcacctgccgcggccccacccacgcgttga

DBGET integrated database retrieval system