KEGG   Xanthomonas phaseoli: XppCFBP6546_10885Help
Entry
XppCFBP6546_10885 CDS       T05156                                 

Gene name
XppCFBP6546P_10885
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xph  Xanthomonas phaseoli
Brite
Enzymes [BR:xph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XppCFBP6546_10885 (XppCFBP6546P_10885)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ATS30231
UniProt: A0A0A6U417
LinkDB All DBs
Position
complement(2415460..2416062)
Genome map
AA seq 200 aa AA seqDB search
MRYRSPTIVAFTALALAACSSTPPPPKAPPPPAARVVPARPVQQAEAALASASGSLVSGR
VVLVPALQGIRLTGTIGGLRPGAVSGFHVHERGDCSAADASSAGAHFNPAGAPHGRAGGG
AHHLGDMDNLRADAEGVAHLDMILSGISLGDGAPTDVIGKSLIVHADPDDYRSQPSGNAG
ARLACGVIRVTQWGTPPSQP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgttaccggtcgcccacgatcgttgccttcaccgcgctggcgctggccgcctgcagc
agcacgccgccgccgcccaaggcgcctccgccgccagcggcgcgggtggtgcctgcgcgc
ccggtgcagcaagccgaggcggcgctggcatctgcctcgggcagcctggtcagcggtcgg
gtagtgctggtgccggcgctgcaaggcattcgcctcaccggcaccatcggcggcttgcgt
ccgggcgccgtgtccggattccatgtgcacgaacgcggcgattgcagcgcagccgacgcc
agcagcgccggcgcgcatttcaacccggccggtgcgccgcacgggcgtgccggtggcggc
gcgcatcatctgggcgacatggacaatctgcgtgcagacgccgaaggcgtggcgcatctg
gacatgattctgtccggcatcagtctgggcgatggcgccccgaccgacgtgatcggcaag
tcgctgatcgtgcatgccgaccccgacgactatcgcagccagcccagcggcaatgccggt
gcgcgcctggcctgtggcgtcattcgcgtcacccaatggggcacgcccccttcgcagccc
tga

DBGET integrated database retrieval system