KEGG   Xenorhabdus poinarii: XPG1_1170Help
Entry
XPG1_1170         CDS       T03805                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex subunit alpha [Includes: Enoyl-CoA hydratase/3-hydroxybutyryl-CoA epimerase; 3-hydroxyacyl-CoA dehydrogenase]
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xpo  Xenorhabdus poinarii
Pathway
xpo00071  Fatty acid degradation
xpo00280  Valine, leucine and isoleucine degradation
xpo00281  Geraniol degradation
xpo00310  Lysine degradation
xpo00362  Benzoate degradation
xpo00380  Tryptophan metabolism
xpo00410  beta-Alanine metabolism
xpo00640  Propanoate metabolism
xpo00650  Butanoate metabolism
xpo00903  Limonene and pinene degradation
xpo00930  Caprolactam degradation
xpo01100  Metabolic pathways
xpo01110  Biosynthesis of secondary metabolites
xpo01120  Microbial metabolism in diverse environments
xpo01130  Biosynthesis of antibiotics
xpo01200  Carbon metabolism
xpo01212  Fatty acid metabolism
Module
xpo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XPG1_1170 (fadJ)
   00650 Butanoate metabolism
    XPG1_1170 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XPG1_1170 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XPG1_1170 (fadJ)
   00310 Lysine degradation
    XPG1_1170 (fadJ)
   00380 Tryptophan metabolism
    XPG1_1170 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XPG1_1170 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XPG1_1170 (fadJ)
   00281 Geraniol degradation
    XPG1_1170 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XPG1_1170 (fadJ)
   00930 Caprolactam degradation
    XPG1_1170 (fadJ)
Enzymes [BR:xpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XPG1_1170 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XPG1_1170 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XPG1_1170 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CDG20825
UniProt: A0A068R3Z2
LinkDB All DBs
Position
1135344..1137524
Genome map
AA seq 726 aa AA seqDB search
MVQTEKETVMPAMQPEQSAFKFSVREDKVGIITFDVPGERVNTLKAECVEQFLLMFEKAQ
HVSGLKGLVILSGKPDSFIAGADISMIAGCQTQEDATALAEKGQKLFAQIAHYPLPVVAA
IHGACLGGGLELALACHARICSLDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGISAALDM
ILTGRQLKAKQAQRLGVVDDTVPADILLDVAVQYVKKGAVKRKPLAWSQRLLASPLGRPL
LFPMVYKKTREKTRGHYPAAEKIISVIRAGLEKGAEKGFQLEAKAFGELAMTQESEALRS
LFFASTALKNETGSSARPAEIKNVGLLGGGLMGGGIANVTITRGNLPVRIKDINEKGINQ
AFKYTWDRLSKRVKQRRLTSSERTRQMSLLTGTLDYRGFQQVDIVVEAVFEDLVLKRKMV
AEIEENTGSETIFASNTSSLPIHKIAEMATRPEKVIGLHYFSPVDKMPLVEVIPHEGTSE
KTIATAVALAKKQGKTAIVVGDKAGFYVNRILAPYINEASYCLVEGEPIEHIDNALVNFG
FPIGPINLLDEVGIDVGTKIIPILVEQLGNRFAAPAILDAILKDDRKGKKNGRGFYSYKS
KQASFWPFGKKSQREVDASIYALLKIKPAVKMLPADIAQRCVMLMLNEAVRCLDEGIIRS
PRDGDIGAVFGIGFPPFLGGPFRYLDKLGSEKVVEILRRLEAQYGERFSPCERLVQMADQ
KKTFYA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggttcagactgaaaaagaaacggttatgccagcaatgcaaccagagcaatcggcattc
aagttttctgtccgggaggataaggtggggatcatcacctttgacgtgccaggcgaaaga
gtgaatacattgaaagccgaatgtgttgaacagtttttgttaatgttcgaaaaagcgcaa
cacgtttcgggtttgaaaggtttggttatcctgtccggtaagcctgatagcttcattgcg
ggtgccgatatcagcatgatcgcgggctgtcagactcaggaagacgccaccgcattggct
gaaaaaggccaaaaactctttgcgcagattgctcattatcctttaccggttgtcgccgcc
attcatggggcatgtttaggtggtgggctggaattggccttggcatgtcacgcgcggatt
tgctctttggatgagaaaacacgtcttggtttgccggaagttcagcttgggttgttaccg
ggttcaggcggaacacagagattgccccgtttgattggtatcagtgcggctttggatatg
atattgaccggtcgtcagcttaaagcgaaacaagcacagcggctaggtgttgtcgatgac
acggttcctgccgatatcttgctggatgttgccgtgcaatatgtgaaaaaaggggcggtg
aaacgtaagccattagcatggtcacagcgtttgttggcaagtccactgggcagaccgttg
ttattcccgatggtttataaaaaaacgcgggaaaaaacacgaggtcattatccggcagcg
gagaaaatcattagtgtgatccgggcgggattggaaaaaggcgcagaaaaaggttttcag
cttgaagccaaagcatttggtgagttggccatgacacaggaatcagaagcattacgtagt
ctgttttttgcgtctactgcgttaaaaaatgaaaccggttcttcagcgcgacccgcagag
attaaaaatgtgggactcctgggcggcggcttgatgggaggggggattgccaatgtcacc
ataacgcggggcaatctgccggttcgtattaaagatattaatgaaaaaggcattaatcag
gcattcaaatatacctgggatcgcctttctaagcgagtgaaacagcgtcgtttgacatca
agtgagcgcactcgtcagatgtctctcctgacaggcactctcgattaccgtggttttcag
caagtggatattgttgtcgaagcggtatttgaagatttggttctgaaacgcaaaatggtt
gctgaaattgaagaaaatacgggatcagaaacgatttttgcctctaacacttcttcattg
cccattcacaagatcgcggaaatggcgactcgaccagaaaaggtgatcggtcttcactat
tttagcccggtagataaaatgccgttagtggaagtgatcccacacgaaggaacgagtgaa
aaaaccattgcaaccgccgtggcattggctaagaaacagggcaaaaccgccatcgttgtc
ggggataaagccggattctatgtcaaccgaattttggcaccttacattaatgaagcgagc
tattgtttagtggaaggagagccaatcgaacatatcgataatgctttggtgaatttcggt
tttcctattggtcccatcaatctgctggatgaagtcggcatcgatgtggggacgaaaatc
atcccgattctggtcgagcaattggggaatcggtttgccgcaccagcgattttggatgca
atcttgaaagatgaccggaagggtaagaaaaatggtcgtggcttctattcttataaaagc
aaacaggcttcattctggccctttgggaaaaaatcgcaaagagaagtcgatgcttcgatc
tacgctttattaaaaatcaaaccggcggtaaaaatgttgcctgctgacattgctcaacgt
tgtgtgatgctgatgttgaatgaagctgttcgctgtctggatgaaggcattattcgaagc
ccccgtgatggggatatcggtgcggtatttggcattggattcccgccgttcctgggaggg
ccattccgttatcttgataaactgggcagtgagaaagtggtcgaaattttacgacgtctg
gaggcgcaatatggggaaaggttttctccgtgtgaacgtttagtccagatggctgaccag
aaaaagacattttacgcatag

DBGET integrated database retrieval system