KEGG   Xenorhabdus poinarii: XPG1_2904
Entry
XPG1_2904         CDS       T03805                                 

Definition
(GenBank) putative membrane protein
Organism
xpo  Xenorhabdus poinarii
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: CDG22551
UniProt: A0A068R6J4
LinkDB
Position
complement(2818402..2819058)
AA seq 218 aa
MSRFRHALKNRDQHILTLRLACGVLVLVLLITLTGWMASPRSLTIHNPPDLRSGSTRPWW
EVPAPSVYSFAFYLFQQLNAWPKNGAQDYPAKIAALSPYLTPACQDFLREDAKTRADSGE
LLDRVRVVYEIPGRGYGTKSVTVRNQDNWVVRLDLVADEYYHAEPVKRALVRYPLKVVRW
EGDAERNPFGLALDCYDGMPQRLEAMPQPVEEKKGVFQ
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagccggtttcgtcatgcgctgaaaaaccgtgaccagcatatcctgaccctgcggctt
gcctgcggggtgctggtactggtcttgctgattacgctcacgggctggatggcctcaccg
cgtagtctcaccatccataatccaccggacttacgcagcggcagcacccgcccgtggtgg
gaagtgcctgcgccgagtgtctacagttttgcgttttatcttttccagcaactgaacgcc
tggccgaaaaacggggcacaggactacccggctaaaattgcggccttgtcgccttatctg
acccccgcctgtcaggattttttacgggaagatgctaaaacccgggccgacagtggtgaa
ctgctcgaccgggtgcgggtggtgtatgagatccctggccggggctacgggacgaaaagt
gtgacggtgcgtaaccaggataactgggtggtgcggctggatttggtggctgatgaatat
tatcacgccgaaccggtcaaacgggcgctggtgcgctatcccctgaaagtggtgcgctgg
gagggcgatgcggagcgtaacccctttgggctggcgctggattgttacgacggaatgccg
cagcgactggaagcgatgccacaacctgtggaagagaaaaagggagtgtttcagtga

DBGET integrated database retrieval system