KEGG   Xenorhabdus poinarii: XPG1_3315Help
Entry
XPG1_3315         CDS       T03805                                 

Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
xpo  Xenorhabdus poinarii
Pathway
xpo00473  D-Alanine metabolism
xpo01100  Metabolic pathways
xpo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XPG1_3315
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    XPG1_3315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xpo01011]
    XPG1_3315
Enzymes [BR:xpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     XPG1_3315
Peptidoglycan biosynthesis and degradation proteins [BR:xpo01011]
 Precursor biosynthesis
  Racemase
   XPG1_3315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDG22951
UniProt: A0A068R7P1
LinkDB All DBs
Position
3232246..3233478
Genome map
AA seq 410 aa AA seqDB search
MRFNKTTLAILLGLGLFQGVAQAAPVLSLDNTHAESIAATNNAWVEINTTTFENNIHTLR
KNLNKGTQLCAVLKGDAYGHGLGLLMPSIIKTDVSCVGITSNEEARLVRESGFKGQLMRV
RTANVSEIESTLGYDMEEMVGDLEQAQAVDALAKKHGKHIRVHLVLNTGLMSRNGLEMKT
EQGKQDALKIAQLPNLKLVGIMSHHALANLDAIRSSINHFQEQTAWLINAANLNRDEITL
HASSSLASMSIPEAQFDMARVGSALYGILPDSHPEYKPLIELKTRVASVKTYPKGNGISY
NNTYTLTRDSKLANLPVGFSDGVSTNLSNKAYVLINGHRAPIVGSITMNTAMVDVTDLPD
VKAGDEVVLFGKQGNNEITQSDIQKWSGQHIVELSSIWGETNPKIVVKGL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttaataaaaccacactggcgatccttcttggtctgggtctgtttcaaggtgtt
gcccaagcagcacctgtgctctctttagataacacccacgcagaaagcatcgcagcaacc
aataacgcttgggttgaaatcaataccacgacgttcgaaaacaatatccacacactacga
aaaaatctgaacaaagggactcaattgtgtgcggtactgaaaggggatgcgtatggccac
gggctcggcctgctgatgccgtctatcattaaaactgatgtgtcttgtgtgggaattacc
agtaatgaagaagcgcgtctcgtccgggaaagcggtttcaaaggacaactcatgcgtgtc
cgtacagccaatgtgagcgaaattgaaagcacattgggctatgacatggaagagatggtt
ggtgatctggaacaagctcaggctgttgatgcgctggctaaaaaacacggaaaacacatt
cgtgttcatctggtattgaataccggtctcatgagccgcaacgggctggaaatgaaaaca
gagcaaggtaaacaagacgctctgaaaatcgctcagctacctaacctgaagctggtcggc
ataatgagccaccatgcactcgctaatctggatgctatccgttccagtattaatcacttc
caggaacaaactgcttggttgatcaacgcagctaatctgaacagagatgaaatcacgctg
cacgcatcaagttcccttgcgtcaatgagcattcctgaagcacagttcgatatggcgcgc
gttggtagtgccctttacggtattctgcccgacagccatccagaatataagccactgatt
gaattaaaaactcgtgttgcttctgttaaaacctacccgaaaggcaatgggattagctac
aacaacacttacacactgacgcgtgattccaaactcgccaacctgcctgttggtttctct
gatggcgtaagcaccaacctgtcaaacaaagcctatgttctgatcaatggtcatcgtgcc
cctattgtggggagcatcaccatgaacaccgcgatggtcgatgtgactgacctgcctgac
gtgaaggccggcgatgaagttgtgctctttggtaaacaaggcaataacgagatcacgcag
tctgatatccaaaaatggagtggtcagcatattgttgagttatcttccatttggggagaa
accaacccaaaaatcgtggtaaagggtctataa

DBGET integrated database retrieval system