KEGG   Xanthomonas sacchari: SB85_04860Help
Entry
SB85_04860        CDS       T03566                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SB85_04860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xsa02000]
    SB85_04860
Enzymes [BR:xsa01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SB85_04860
Transporters [BR:xsa02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SB85_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 Rad17 AAA_29 AAA_23 AAA_16 RsgA_GTPase AAA_30 AAA_15 NACHT AAA_25 AAA_5 AAA_24 AAA_33
Motif
Other DBs
NCBI-ProteinID: AJC47510
UniProt: A0A0A8DZW1
LinkDB All DBs
Position
1195482..1196309
Genome map
AA seq 275 aa AA seqDB search
MNDHHNAAPMHRIAMPNGHTALAPSPVKIAARGLDFYYDKYHALKGINLEVPEKRVTALI
GPSGCGKSTLLRIFNRIYALYPKLEARGEVLLDGENILSPKYPMNRLRSKVGMVFQKPVP
FPMTIFENVAYGIRHHEKLSKADMADRVEQALRQGALWDEVKDKLGQSALGLSGGQQQRL
CIARAVALRPDVLLLDEPTSALDPISTSRIEQLVEELKNDYTIVIVTHNMQQAARVSDYT
AFMYLGDLIEHDRTEIIFSQPNKQQTEDYITGRFG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaccacaacgccgccccgatgcaccgcatcgccatgcccaacgggcacacc
gcgctggcgccgtcgccggtcaagatcgccgcgcgcggcctggacttctattacgacaag
taccatgcgctgaagggcatcaacctggaagtgccggagaagcgcgtcaccgcactgatc
ggcccctccggctgcggcaagtccaccctgctgcgcatcttcaaccggatctacgcgctg
tacccgaagctggaagcgcgcggcgaggtgctgctggacggcgagaacatcctctcgccg
aagtacccgatgaaccgcctgcgcagcaaggtcggcatggtgttccagaagccggtgccg
ttcccgatgaccatcttcgagaacgtcgcctacggcatccgccaccacgagaagctgtcc
aaggccgacatggccgaccgcgtcgagcaggcgctgcgccagggcgcgctgtgggacgag
gtcaaggacaagctcgggcagagcgcgctgggcctgtccggcggccagcagcagcgcctg
tgcatcgcccgcgcggtagcgctgcgtccggacgtgctgctgctcgacgagccgacctcg
gcgctggacccgatctcgaccagccgcatcgagcagctggtggaagagctgaagaacgac
tacaccatcgtcatcgtcacccacaacatgcaacaggccgcgcgcgtgtccgactacacc
gccttcatgtacctgggcgacctgatcgagcacgaccgcaccgaaatcatcttctcgcag
ccgaacaagcagcagaccgaagactacatcaccggccgtttcggctga

DBGET integrated database retrieval system