KEGG   Xanthomonas sacchari: SB85_12750Help
Entry
SB85_12750        CDS       T03566                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00010  Glycolysis / Gluconeogenesis
xsa00620  Pyruvate metabolism
xsa01100  Metabolic pathways
xsa01110  Biosynthesis of secondary metabolites
xsa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SB85_12750
   00620 Pyruvate metabolism
    SB85_12750
Enzymes [BR:xsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SB85_12750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJC46503
UniProt: A0A0A8DXM3
LinkDB All DBs
Position
3063546..3065075
Genome map
AA seq 509 aa AA seqDB search
MNAVSTAKPHATDPQSIFKSRYGNFIGGKWVEPKSGQYFDNSTPITGKVFTAVARSNAED
IEAALDAAHAAKDAWGKTSSTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMEVIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYERFMEKALKRVAAIKQGNPLDPNTMVGAQASGEQLEKILSYID
IGKQEGAEVLIGGERNALEGDLAGGFYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDEA
EALAIANDTLYGLGAGVWSRDAARLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtcagcaccgccaagccgcatgccaccgatccgcagtccatcttcaagtcg
cgctatggcaacttcatcggcggcaagtgggtggagccgaagagcggccagtacttcgac
aacagcacgccgatcaccggcaaggtgttcaccgcggtggcgcgttccaacgcagaggac
atcgaggccgcgctcgacgccgcgcacgccgccaaggacgcctggggcaagacctccagc
accgagcgcagcaacgtgctgctgaagatcgccgaccgcatcgagcagaacctggagctg
ctggcctatgccgagacctgggacaacggcaagccggtgcgcgagacgctcaacgccgac
gtgccgctgtgcgtggaccacttccgctacttcgccggcgcggtgcgcgcgcaggaaggc
ggcatctccgagatcgaccacgacaccatcgcctaccacttccacgaaccgctcggcgtg
gtcgggcagatcatcccgtggaacttcccgctgctgatggcgtgctggaagctggcgccg
gcgctggcggcgggcaactgcgtggtgatgaagccggccgagcagaccccggcctcgatc
ctggtgctgatggaggtcatcggcgacctgctgccgccgggcgtgctcaacgtggtcaac
ggtttcggcctggaggcgggcaagccgctggccagcaacccgcgcatcgccaagatcgcc
ttcaccggcgagaccaccaccggacggctgatcatgcagtacgccagccagaacctgatc
ccggtgacgctggagctgggcggcaagtcgccgaacatcttcttcgccgacgtgatggcc
gaggacgacgacttcctcgacaaggcggtggaaggcttcgtgctgttcgccttcaaccag
ggcgaggtctgcacctgtccgtcgcgcgcgctgatccaggaatcgatctacgagcgtttc
atggagaaggcgctcaagcgggtggcggcgatcaagcagggcaacccgctcgatcccaat
accatggtcggcgcacaggcgtccggcgagcagttggagaagatcctgtcctacatcgac
atcggcaagcaggaaggcgccgaggtgttgatcggcggcgaacgcaacgcgctcgagggc
gacctggccggcggtttctacgtcaagccgacggtgttcaaaggccacaacaagatgcgc
atcttccaggaggagatcttcggcccggtggtgtcggtgaccacgttcaaggacgaggca
gaggcgctggcgatcgccaacgacacgctgtatgggctgggcgccggcgtgtggagccgc
gatgccgcgcggctgtatcgcatgggccgcgcgatccaggccgggcgggtgtggaccaac
tgctaccacgcctatccggcgcatgccgcgttcggcggctacaagcagtcgggcatcggc
cgcgagaaccacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagc
tattcgccgaaggcgctgggcttcttctga

DBGET integrated database retrieval system