KEGG   Xanthomonas sacchari: SB85_12765Help
Entry
SB85_12765        CDS       T03566                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00010  Glycolysis / Gluconeogenesis
xsa00071  Fatty acid degradation
xsa00350  Tyrosine metabolism
xsa00625  Chloroalkane and chloroalkene degradation
xsa00626  Naphthalene degradation
xsa01100  Metabolic pathways
xsa01110  Biosynthesis of secondary metabolites
xsa01120  Microbial metabolism in diverse environments
xsa01130  Biosynthesis of antibiotics
xsa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SB85_12765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SB85_12765
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SB85_12765
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SB85_12765
   00626 Naphthalene degradation
    SB85_12765
Enzymes [BR:xsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SB85_12765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AJC46505
UniProt: A0A0A8DX02
LinkDB All DBs
Position
3067536..3068564
Genome map
AA seq 342 aa AA seqDB search
MDKTMKAAVVREFGKPLAIEEVTVPRPQAGDILVRIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGAGVDHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEAQQNSGYSV
NGGFAEYALANANYVGHLPKNIGFVEIAPILCAGVTVYKGLKVTDTKPGNWVVISGIGGL
GHMAVQYAKAMGLNVAAVDVDDAKLALATRLGATVTVNARTTDPVAYLKKEIGGAHGALV
TAVSPKAFEQAIGMVRRGGTVSLNGLPPGQFPLDIFGMVLNGVTVRGSIVGTRLDLQESL
EFAAQGKVAATVATDTLDNINDVFARMHAGKIEGRIVLDMAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacgatgaaagcagccgtggtgcgggagttcggcaagccgctggcgatcgag
gaggtgacggtgccgcggccgcaggccggcgacatcctggtcaggatcgaagcctgcggc
gtgtgccacaccgacctgcacgcggccgagggcgactggccggtgaagccgaatccgccg
ttcattccgggccatgagggcgtgggccacgtagtggcggtcggcgccggcgtggaccac
gtcaaggaaggcgaccgcgtcggcattccgtggctgtactcggcctgcggccattgcgag
cattgcctgggcggctgggaaacactgtgcgaggcgcagcagaactccggctactcggtc
aacggcggcttcgccgaatacgcgcttgccaatgccaactatgtcggccatctgccgaag
aacatcggtttcgtcgagatcgccccgatcctgtgcgccggcgtcaccgtgtacaagggc
ctgaaggtcaccgacaccaagcccggcaactgggtggtgatctccggcatcggcggcctc
ggccacatggcggtgcagtacgccaaggcgatgggcctgaacgtggccgcggtggacgtg
gacgacgccaagctggcgctggccacgcgcctgggcgcgacggtgacggtgaacgcgcgg
accaccgatccggtggcgtacctgaaaaaggaaatcggcggcgcgcacggtgcgctggtc
accgcggtctcgccgaaggcgttcgagcaggccatcggcatggtccgccgcggcggcacc
gtctcgctcaacggcctgccgccgggccagttcccgctggacatcttcggcatggtgctc
aacggcgtgaccgtgcgcggctcgatcgtcggcacccgcctggacctgcaggagtcgctg
gagttcgccgcgcagggcaaggtcgccgcgaccgtggccaccgacaccctggacaacatc
aacgacgtgttcgcgcgcatgcacgccggcaagatcgaaggccgcatcgtgctggacatg
gccgcctga

DBGET integrated database retrieval system