KEGG   Xanthomonas sacchari: SB85_16315Help
Entry
SB85_16315        CDS       T03566                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00591  Linoleic acid metabolism
xsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    SB85_16315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xsa01004]
    SB85_16315
Enzymes [BR:xsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     SB85_16315
Lipid biosynthesis proteins [BR:xsa01004]
 Desaturase
  Front-end
   SB85_16315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AJC47067
UniProt: A0A0A8E0D1
LinkDB All DBs
Position
4000035..4001159
Genome map
AA seq 374 aa AA seqDB search
MAAPRNRALTPAELQAFGDELDALRMRTLADLGARDARYIRRIVAAVRYTGVAGRALLFL
GAFVHSVLVPAWIAGVLLLTLSKILENMELGHNVMHGQYDWMGDAHLNGNTYEWDIVATG
DNWRKTHNFKHHTYTNVRGMDDDIGYGLLRIFPEQRWRPFYLAQPFIAVVFALLFEWGVA
IQDLRLGRWLAGKMKRGELKRTFLPVGRKMGRQIFKDYILFPALAGPFFLPVLLGNLAAN
VLRSIWTFVIIFCGHFTADAETFPKDSIKNESRGHWYLRQLRGSSNLAGGKLLNVLSGNL
SHQIEHHFFPDVPANRYAALAVQVREICARYGQHYNTGSLPRQFGQVVWRIVRHAFPSRP
RPVRALQPATQQAG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccccgcaaccgcgcactcaccccggccgaactgcaggccttcggcgacgaa
ctggatgcgctgcgcatgcgcaccctggccgacctgggcgcgcgcgatgcgcgctacatc
cgccgcatcgtcgccgcggtgcgctacaccggcgtggccggccgcgcgctgctgttcctg
ggcgcattcgtgcacagcgtgctggtgccggcctggatcgccggcgtgctgctgctgacc
ctgtccaagatcctggagaacatggagctgggccacaacgtgatgcatggccagtacgac
tggatgggcgatgcgcacctgaatggcaacacctacgagtgggacatcgtcgccaccggc
gacaactggcgcaagacgcacaacttcaagcaccacacctataccaacgtgcgcggcatg
gacgacgacatcggctatggcctgctgcggatcttccccgagcagcgctggcgcccgttc
tacctggcgcagccgttcatcgcggtggtgttcgcgctgctgttcgaatggggcgtggcg
atccaggacctgcgcctgggccgctggctggccggcaagatgaagcgcggcgaattgaag
cgcacgttcctgccggtcgggcgcaagatgggccggcagatcttcaaggactacatcctg
ttcccggcgctggccggcccgttcttcctgccggtgctgctgggcaacctggccgccaac
gtgctgcgcagcatctggaccttcgtgatcatcttctgcggccacttcaccgccgatgcc
gagaccttccccaaggactcgatcaagaacgagtcgcgcgggcactggtacctgaggcag
ctgcgcggttcctccaatctggccggcggcaagctgctgaacgtgctgtcgggcaacctc
agccaccagatcgagcaccatttcttcccggacgtgccggccaaccgctacgcggcgctg
gcggtgcaggtgcgcgagatctgcgcgcgctacggccagcactacaacaccggctcgctg
ccgcggcagttcggccaggtggtgtggcggatcgttcgccacgccttcccgagccggccg
cgcccggtgcgcgcgctgcagccggcgacgcaacaggccggctga

DBGET integrated database retrieval system