KEGG   Xanthomonas translucens: FD63_03580Help
Entry
FD63_03580        CDS       T03961                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xtn  Xanthomonas translucens
Brite
KEGG Orthology (KO) [BR:xtn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FD63_03580
Enzymes [BR:xtn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FD63_03580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AKK66629
UniProt: A0A0G3LJ46
LinkDB All DBs
Position
complement(821221..822810)
Genome map
AA seq 529 aa AA seqDB search
MLDADLKTQLKAYLERVVRPIHITASVDDGAKSREMLDLLEDLVLLSDQISLDVHRDSAE
RTPSFALSSPGHDIHLRFAGLPLGHEFTSLVLALLQVGGHPSKATAEVIEQVRNLPGDYV
FETYFSLSCQNCPDVVQALNLAAVLNPNIKHVAIDGALFQDEVEARQIMSVPTVYLNGDV
FDQGRMSLEQIVAKLDTGAAKRDAANIAAKAPFDVLVIGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVQETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LVEIKLANGASLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLVEFDAKLRADEVLQRKLRSLGNVDIIVNAQSTEVIGDG
SKVTGLVYKDRVGGDVHRLALEGIFVQIGLLPNTEWLQGTVALSPRGEIVVDDRGQTSLP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDHLIRSSAPVSSAVAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccgatctgaaaacccagttgaaggcttacctggagcgggtcgttcggccc
atccacatcaccgcgtcggtggacgacggcgccaagtcgcgcgagatgctcgacttgctc
gaggacctggtgctgctatcggaccagatcagcctggacgtgcatcgcgacagcgccgag
cgcacgccgtcgttcgcgctgagcagccccggccatgatatccacctgcgcttcgccggg
ctgccactgggtcacgagttcacctcgctggtgctggcgctgctgcaggtcggcgggcat
ccgtccaaggccaccgccgaggtcatcgagcaggtgcgcaacctgcccggcgactacgtg
ttcgaaacctacttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcggtactgaacccgaacatcaagcacgtggcgatcgacggcgcgctgttccag
gacgaggtggaagcgcggcaaatcatgtcggtgcccaccgtctacctcaacggcgacgtg
ttcgaccagggccgcatgagcctggagcagatcgtggccaagctcgacaccggcgcggcc
aagcgcgacgcggccaatatcgcggccaaggcgccgttcgacgtgctggtgatcggcggc
ggcccggccggcgcagcggcggcgatctatgcggcgcgcaaaggcatccgcaccggggtg
gcggccgagcgcttcggcggccaggtgctggacaccatggcgatcgagaacttcatttcg
gtgcaggagaccgaaggcccgaagatggccgcggcgctggagcagcacgtgcgccaatac
gacgtggacatcatgaacctgcagcgcgccgagcagctgatcccggccggcgccgacggc
ctggtcgagatcaagctggccaacggcgcgtcgctgaagagccgcagcgtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgcctggcgaagaccagtaccgcaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtggaagcggcgatcgacctggccggcatcgtcagccatgtc
accctggtcgagttcgacgccaagctgcgcgccgacgaagtcctgcagcgcaagctgcgc
agcctgggcaacgtggacatcatcgtcaacgcgcagagcaccgaggtgatcggcgacggc
agcaaggtcaccggcttggtctacaaggaccgcgtcggcggcgacgtccaccgcttggcg
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgaatggctgcagggcacc
gtggcgctgtcgccgcgcggcgagatcgtggtcgacgaccgtggccagacctcgctgccc
ggcgtgttcgccgccggcgatgccaccacggtgccgtacaagcagatcatcatcgccatg
ggcgaaggctccaaggcggcgctgagcgcgttcgaccacctgatccgcagcagcgcgccg
gtcagcagcgcggtcgccgaagcggcctga

DBGET integrated database retrieval system