KEGG   Xanthomonas translucens: FD63_08200Help
Entry
FD63_08200        CDS       T03961                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xtn  Xanthomonas translucens
Pathway
xtn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xtn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FD63_08200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtn02000]
    FD63_08200
Enzymes [BR:xtn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FD63_08200
Transporters [BR:xtn02000]
 Other Transporters
  Pores ion channels [TC:1]
   FD63_08200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AKK67456
UniProt: A0A0G3LK97
LinkDB All DBs
Position
1864686..1865381
Genome map
AA seq 231 aa AA seqDB search
MITVHHLNQSRSQRVLWLLEELALPYQVVKYQRDPQTMLAPPELRAIHPLGKSPVLADDG
HVLAESGAILDYLVERYDTVRALSPSPQPLEAPERLRYRYWMHYAEGSAMPPLLMSLVFG
RIRSAKMPFFARPIARAIVDKAMHGFVGPQLTLHLDWMERELAATGWFAGERFTAADVQM
SFPVQAAAARAGLQAYPNLAGFVQRIEQRPAYRRALQQGGPFELLGSVKAG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccatcacctcaaccagtcccgttcccagcgcgtgctgtggctgctggag
gaactggcgctgccctaccaggtggtcaagtaccagcgcgacccgcagaccatgctggcg
ccgccggaactgcgcgcgatccatccgctgggcaagtcgccggtgctggccgacgacggc
cacgtgttggccgaatccggcgcgatcctcgattacctggtggagcgctacgacaccgtg
cgcgcgctgtcgccttcgccgcagccgctggaggcgcccgagcgcctgcgctaccgctac
tggatgcattacgccgaaggctcggcgatgccgccgctgctgatgagcctggtgttcggg
cgcatccgttcggcgaagatgccgttcttcgcgcggccgatcgcccgcgccatcgtcgac
aaggcgatgcacggcttcgtcggcccgcagctgacgctgcacctggactggatggagcgc
gagctggccgccaccggctggttcgccggcgagcgcttcaccgccgccgacgtgcagatg
agcttcccggtgcaggctgcggccgcacgcgccgggctgcaggcctatccaaacctggcc
ggcttcgtgcaacgcatcgagcagcgcccggcctaccggcgcgcgctgcagcagggcggg
ccgttcgagctgctcggcagcgtcaaggccggctga

DBGET integrated database retrieval system