KEGG   Xanthomonas translucens: FD63_16030Help
Entry
FD63_16030        CDS       T03961                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xtn  Xanthomonas translucens
Pathway
xtn00550  Peptidoglycan biosynthesis
xtn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xtn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FD63_16030
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FD63_16030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xtn01011]
    FD63_16030
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtn03036]
    FD63_16030
Enzymes [BR:xtn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FD63_16030
Peptidoglycan biosynthesis and degradation proteins [BR:xtn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   FD63_16030
Chromosome and associated proteins [BR:xtn03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    FD63_16030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKK68871
LinkDB All DBs
Position
complement(3718490..3720355)
Genome map
AA seq 621 aa AA seqDB search
MSKAGRNRPRSNFNLRGRLVLVGAALSLCSVTLIGRAAYVQIINSDFYQRQGEARYLREL
PIATSRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPQLAQALELPSDELTAKLSQ
KSDKEFMYLKRRINPDKAHAVVALGIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQE
GLELAYDEWLRGKPGSKRVIRDRKGAIVESIDLVKPAEPGKDLTLSIDRRIQFLAYKELR
NALAQNNAAGGSIVVMDVATGEIMAMVNLPTYNPNSVTGVNSDARRNRAVTDLVEPGSTM
KPLTISTALKAGVVTKDTLIDTNPGYMAVGRFTIKDVPRNNGVLTVTGVITRSSNIGAAK
IGAKLPDQTFYDQIHSYGYGSAPHSGFPGESAGVLPPPGRWSGSSKTTMSYGYGLSVTPL
QIARAYCALGNGGKLVTPTFIKGQHEETKGVLSPAIAKEVVTMMETVVTQGGAKGAAILG
YHVAGKTGTARLNGPGGYIRGHYNALFAGLVPASNPRFATVIVINDPQGAKYYGGLVSAP
VFHNVMEGALRLMDVPPDDIQAWLAAQAAGKSGHAPPPVPVEPDPALVPDAAAEVEAALP
SVRAVAPPPAAPPVPVQETRQ
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggccggccgcaatcgcccgcgcagcaacttcaatctccgtggccggctggtg
ctggtcggtgcggcgctgagcctgtgctcggtcaccctgatcggccgcgccgcctacgtg
cagatcatcaacagcgatttctaccagcgccagggcgaggcgcgctacctgcgcgagctg
ccgatcgccacctcgcgcggcatgatcaccgaccgcaacggcgagccgctggcggtgtcc
acgccggtggagtcgatctgggtcaatccgcaggagctgctgcgcaatcccgaccgcatt
ccgcaactggcgcaggcgctggaactgcccagcgacgaactgaccgccaagctgtcgcag
aagtcggacaaggagttcatgtacctcaagcgccggatcaatccggacaaggcgcatgcg
gtggtcgcgctgggcatcccgggcgtgttctcgcagcgcgagttccgccgcttctacccg
cagggcgaagcgatggcgcacgtgctcggcttcaccaacatcgacgaccgcggccaggaa
gggctggagctggcgtacgacgaatggctgcgcggcaagcccggctccaagcgcgtgatc
cgcgaccgcaagggcgcgatcgtggagagcatcgacctggtcaagccggccgagccgggc
aaggacctgaccctcagcatcgatcgccgcatccagttcctggcctacaaggaattgcgc
aacgcgttggcgcagaacaacgctgccggcggttcgatcgtggtgatggacgtggccacc
ggcgagatcatggccatggtcaacctgccgacctacaacccgaactcggtcaccggggtc
aattccgatgcgcgccgcaaccgcgcggtcaccgacctggtcgagccgggttcgacgatg
aagccgctgaccatctccaccgcgctgaaggccggggtggtgaccaaggacacgctgatc
gacaccaacccgggctacatggcggtcggtcgcttcaccatcaaggacgtgccgcgcaac
aacggcgtgctgaccgtgaccggggtgatcacccgcagttccaacatcggcgcggccaag
atcggcgccaagctgccggaccagaccttctacgaccagatccacagctacggctacggc
agcgccccgcacagcggcttccccggcgaatcggccggcgtgctgccgccgccgggacgc
tggagcggctcgtccaagaccaccatgtcctacggctacggcctgtcggtgacgccgctg
cagatcgcgcgcgcctactgcgcgctcggcaacggcggcaagctggtgacgccgaccttc
atcaaggggcagcacgaagaaaccaagggcgtgctgagcccggcgatcgccaaggaagtg
gtgacgatgatggaaaccgtggtgacccagggcggcgccaagggcgcggcgatcctcggc
taccatgtcgccggcaagacaggtaccgcgcgcctgaacggtcccggcggctatatccgc
ggccactacaacgcgctgttcgccggcctggtgccggccagcaatccgcgcttcgccacg
gtcatcgtgatcaacgatccacagggcgccaagtactacggcggcctggtctcggcgccg
gtgttccacaacgtgatggaaggcgcgctgcggctgatggacgtgccgccggacgacatc
caggcgtggctggcggcgcaggccgccggcaagagcgggcatgcgccgccgccggtgccg
gtggagccggacccggcgctggtgcccgatgccgccgccgaagtggaagcggcgctgccg
agcgtgcgcgccgtcgcgccgccgccggccgcgccgccggtgccggtgcaggagacccgc
cagtga

DBGET integrated database retrieval system