KEGG   Xenopus tropicalis (western clawed frog): 100036641Help
Entry
100036641         CDS       T01011                                 

Gene name
tmem63c
Definition
(RefSeq) transmembrane protein 63C
  KO
K21989  calcium permeable stress-gated cation channel
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100036641 (tmem63c)
Transporters [BR:xtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100036641 (tmem63c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RSN1_7TM PHM7_cyt RSN1_TM DUF4131 DUF5392
Motif
Other DBs
NCBI-GeneID: 100036641
NCBI-ProteinID: NP_001090668
Xenbase: XB-GENE-992232
UniProt: A0JP96
LinkDB All DBs
Position
8
AA seq 801 aa AA seqDB search
MDILYRTESPLGDSLSMDPPVNETEQCYKAHSHSTVLQGLPFGGIPTVLAINFLAWLVLL
LIFSCLRKAAWDYGRLALLIDNDSLTSLFYGEPSEKEKSPCEISPSEASTKDVGLCSWLS
SIYQMKDEEIQSKCGSDAITYLSYQRHLLVVLLAVCCISVAIILPVNFSGDMLGDSPAQF
GRTTIVNVPTKDRFLWLHSVFALVYFLFSVLCMRHHTSSLHYKEDDKVARTLMITKIPSE
ISDASLFTKHFHEAYPSCTVTDVQFCYDVRHLMKLDKERRRAMKGRMYFAGRAQKEGKIQ
IKIHPCARLCPCDCCGFQQVEAEQYYGELEERLTDEFTAERNRITLKRLGAVFVTFQDER
MTAVIIKDYNRLPCHRAPQQSSVTPLLKSHKWKVHYAPAPSDIIWENLAVSGALWWFRFL
ALNLLLFVLLFFLTTPAVIVSTMDRFNVTYPVEKLRNPVITQFLPTFLLWMFSVCLPFLV
YYSAFFECHWTRSSENQHTMHKCYFFLVFMVIVLPSLGLTSLNLFFRWLFDIHFLDEANI
KFQCVFLPNNGAFFVNYVITASLIGTAMELLRFPGLTVYAARLCLARTEPDRLHVKRNQA
YEFQFGLEYAWTTCVFSVVMAYSITCPVIVPFGLIYMLLKHMTDRYNIYYAYIPTKLSPG
LHKAAAYQMLAAPVLCIFWLLFFSVLRLGSTHPVTLFTFAVLLFCLLFSTFGLCLKKLQP
NRPSSYQMSEPNEGIIQDTERSSISSTIQSNVFVASVLQEQELSPLASPAHASYGALETR
TDTPGDEQETTPESMVGDTCH
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggatatcctatacagaactgagagtcctttgggggactccctgtccatggaccctcca
gtaaatgagactgagcaatgttataaagcgcattcacacagcacagttctgcaggggctt
ccatttggtgggatccctactgtgctagccatcaacttcctggcttggctggttctactg
ctaatattctcctgcctaaggaaggctgcttgggactatggacgtttggcattgctgata
gacaatgacagtctcacttctctgttttacggggagcctagtgaaaaagagaaatcgccc
tgtgagatcagtccttctgaagcaagcaccaaagatgtgggcctgtgttcctggctcagc
tccatttatcaaatgaaggatgaggagattcagagtaaatgtggatcagatgctattacg
tacttgtcttatcaacgtcatcttctggtggtgctgctggctgtctgttgcatctcagtg
gccatcatactgcctgttaacttctctggagatatgctaggtgacagtccagctcagttt
ggccgaaccaccatcgtcaatgtacctactaaggatcgtttcctttggctgcacagtgtt
tttgcacttgtctattttctcttctcagtgctgtgtatgcgccatcatacctcttcactg
cactacaaagaggatgacaaggttgcaagaacactgatgattacaaaaatcccaagcgag
atctcagatgcatcactgtttactaaacatttccatgaggcctatcccagctgcactgta
acagatgtccaattttgctatgatgtgcgtcacctaatgaagctggataaagagaggcgg
cgagctatgaaaggacgcatgtattttgctggtcgtgctcaaaaagaagggaaaattcag
atcaaaattcacccatgtgccagactttgcccatgtgattgctgtggctttcagcaggtg
gaggctgagcagtattatggggagctggaagagagactgacagatgaatttacagcagaa
aggaatcggattactctgaagaggctgggtgctgtatttgtcacatttcaggatgaaaga
atgacagcagtgataatcaaagattataacagactgccctgccacagagcacctcagcaa
tcgtcagtcaccccgttgctaaaatcacataagtggaaggtacattatgccccagcacca
agtgatatcatttgggagaacctggcggtgtctggagcattgtggtggtttcggttcttg
gctttgaacctgttgctgtttgttctgctcttcttcttgacaacacctgctgtcatagtc
agcaccatggacagattcaatgttacttacccagtggagaaactgcgaaaccctgttatc
actcaattccttccaacgtttctcctctggatgttttctgtgtgcctccctttcttggtt
tactattcagctttcttcgaatgtcactggacaagatccagtgaaaaccagcacacaatg
cacaaatgctatttctttcttgtattcatggttattgtcttgccttctctgggtctaaca
agtttgaatctattctttcgctggttgtttgacattcactttttggatgaagcaaacata
aaattccagtgtgttttccttcccaataatggggcattctttgtgaactatgtgatcaca
gccagtctcattggcactgccatggagttgcttcgattcccagggctcacagtgtatgca
gcacgtctttgccttgctaggacagagccagatcgccttcatgttaaacggaaccaagcc
tatgagttccagttcggacttgagtatgcttggaccacatgtgtcttctctgtggttatg
gcatacagcattacatgtcctgtaattgttccttttggactcatatacatgcttctgaag
catatgaccgatagatataacatatactatgcctacattcctacaaagctgagtcctgga
ctgcacaaggcagctgcctaccaaatgcttgcagctcctgtactttgcatattctggtta
ttgttcttctcagtactgcgtctgggttccacgcacccagtcactttgtttacctttgct
gtcctcctcttttgtttacttttctctacttttgggctttgtctcaagaagctgcaacca
aacagaccatccagttatcagatgtctgaacccaatgaggggatcatccaagatacagaa
cgaagcagcatatcctccacaatccagtccaatgtgtttgtagcttctgtcctgcaagag
caagagctttctccattggcctcccctgcacatgcctcatatggagcactggagacccgc
acagacactcctggtgatgagcaggagacaacccctgagtccatggtgggggatacctgc
cactga

DBGET integrated database retrieval system