KEGG   Xenopus tropicalis (western clawed frog): 100038054
Entry
100038054         CDS       T01011                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04110  Cell cycle
xtr04115  p53 signaling pathway
xtr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100038054 (cdkn1a)
   04068 FoxO signaling pathway
    100038054 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100038054 (cdkn1a)
   04115 p53 signaling pathway
    100038054 (cdkn1a)
   04218 Cellular senescence
    100038054 (cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100038054
NCBI-ProteinID: XP_002935824
Xenbase: XB-GENE-487802
UniProt: F7ELE6
LinkDB
Position
2
AA seq 143 aa
MSQEKMQSAIAILKQASGNKEKACRMLFEAVDHEQLKTEFHELMQRSNEEAKAKWNFDFV
TETPLEGQYDWEKVEDKTLNCNSQESEKENQCQDVAAEMCNINQSHKASQNCESSDSGKR
KQKLITDFYPVKRRCSPKPSPRD
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagtcaagagaaaatgcagtcagccatagccatcctcaagcaagcatctggaaataag
gaaaaggcttgtcgaatgctttttgaagctgtggaccatgaacagctaaaaactgaattt
catgaacttatgcagagatccaacgaggaagcaaaagctaaatggaactttgactttgtc
actgaaactcctcttgaagggcaatatgattgggagaaggtagaagacaaaaccttgaat
tgcaattcgcaggaaagtgaaaaagaaaaccagtgccaagatgtagccgcagagatgtgt
aacattaaccaatcccataaagcttcccagaattgtgaaagcagcgattcaggcaaaagg
aaacaaaagctgatcacagatttttatcctgtcaagcggagatgttcacctaaacccagc
ccccgcgattga

DBGET integrated database retrieval system