KEGG   Xenopus tropicalis (western clawed frog): 100124752Help
Entry
100124752         CDS       T01011                                 

Gene name
hk1, Hexokinase
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00051  Fructose and mannose metabolism
xtr00052  Galactose metabolism
xtr00500  Starch and sucrose metabolism
xtr00520  Amino sugar and nucleotide sugar metabolism
xtr00524  Neomycin, kanamycin and gentamicin biosynthesis
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
xtr04910  Insulin signaling pathway
Module
xtr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xtr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100124752 (hk1)
   00051 Fructose and mannose metabolism
    100124752 (hk1)
   00052 Galactose metabolism
    100124752 (hk1)
   00500 Starch and sucrose metabolism
    100124752 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    100124752 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100124752 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100124752 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100124752 (hk1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100124752 (hk1)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100124752 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100124752
NCBI-ProteinID: NP_001096201
Xenbase: XB-GENE-944850
UniProt: A4II49
LinkDB All DBs
Position
7
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRLSDETLLDIMGRFRAEMANGLSRDTNPTAI
IKMLPTFVRSIPDGTEKGDFIALDLGGSHFRILRVKVSHEKKQTVQMESEIYDTPEDIIH
GSGTRLFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDMVEGDEGRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNKGVPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPESDVRFLLSESGSGKGAAMVTAVAYRLSEQRRQIDETLEEFKLS
REQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGF
TFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAIVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVDGDQGRMCVNMEWGAFGDNGCLDD
IRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTS
IFETKFLSQIESDRLALLQVRSILQQLGLNSTCDDSIIVKEVCGAVSRRAAQVCGAGMAA
VVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLAPKCNVSFLLSEDGSGKG
AALITAVACRLRSSEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcccagctgctagcatattacttcacagaacttaaagatgatcagctgaag
aagattgataaatatttgtactctatgcgcctctccgatgaaaccttactggatattatg
gggaggttccgagcagaaatggcaaatggtctttcaagggacacaaatcccacagcaatt
atcaagatgctgccaacatttgtaagatcaattcctgatggaacagaaaagggagatttc
attgctctggatttgggtggatctcatttccgcattttgagagtgaaagtttcgcatgag
aagaagcagacggttcagatggagagtgagatctatgacacaccagaggatattatccat
ggcagtggtacccgactttttgaccatgttgctgaatgccttggagacttcatgcagaag
aagcagatcaaagacaaaaagctgcctgttggatttaccttctccttcccttgtatacaa
accaaaatagatgagggtgtactagttacctggaccaagagattcaaagccagtggggtt
gagggaatggatgttgtgaaactgctaaataaggcgatcaagaaacgcggggactatgag
gcagatataatggctgtcgtgaatgacacagttgggacaatgatgacttgtgggtttgat
gaccagagatgtgaagtcggtataattataggtactgggaccaatgcttgctacatggaa
gagctgaggcacattgatatggtggaaggggatgagggtcgaatgtgcattaacactgag
tggggagcatttggtgacgatgggtgtctggaggacatcaggtcggagttcgacagagag
atagacagaggttcactcaatccaggaaaacagctgtttgaaaagatggtcagcggcatg
tacatgggggaacttgtcagacttatcctggtaaaaatggccaaagaaggactcctattt
gaagggagaattactcctgaacttctgaccagaggaaaatttgaaacaaagcatgtttct
gcaatcgagaagagcaaagaaggtttaagcaaagccaaagacatactgaccagacttggg
gtggagccatctcacgaagactgcattgctgtgcagcatgtatgtacaatcgtgtccttc
cgctctgctaatctagttgctgctacgcttggtggaatcctcatacgactgagggacaat
aaaggggttcccaggctgcgtactactgtgggcatcgatggatccttatacaagatgcat
ccacaatatgccaggcgcttacacaaaacagtaaggcgactggttcctgagtcggatgtg
agattcctcttatcagagagtggaagtggcaaaggagctgccatggtgactgcggtggca
tacaggctgtcagagcagagaaggcagatcgatgagaccttagaagagttcaagctcagc
cgtgaacagttgcttgaggttaagaggaggatgcggattgaaatagagaatggactcagg
aaaaagacccatgaatcagcaaaggttaaaatgttgccaacgtatgtaaggagtacaccc
gatggtacagaaaatggagactttctggctctggaccttggtggcacaaactttagagtt
ttacttgtgaaaattcgaagtggaaaaagaagaaccgtggaaatgcacaataaaatttac
gccatccctatagatgtcatgcaggggacaggggaagagctctttgatcacattgctcat
tgtatttctgatttcctggattacatgggaataaagggagcaagacttccgctgggcttc
actttctcgttcccctgcatgcagaccagcttggatgctggcatcttagtcacatggacc
aaaggtttcaaggccactgattgtgaaggagaagatgtggttaatttattaagagaagga
attaagagaagagaggagtttgacctggatgtggttgcgattgtgaatgatacagtagga
accatgatgacctgtgcatatgaagatccaaactgtgaaattggtctcattgtggggact
ggaagcaatgcatgctacatggaagaaacaaagaatatagaaatggtggacggagaccag
ggaagaatgtgtgtgaacatggaatggggagcgtttggggacaatggttgccttgatgat
atccgcacagtctatgataaggctgttgatgatttgtcattaaattcaggaaaacagagg
tacgagaagatgatcagtggcatgtatttaggagaaattgtgcgcaacatattaattgac
ttcacaaaaagaggatttctgttcagagggcagattagtgaggcactgaaaaccacaagt
atctttgaaaccaaattcctttcccaaattgagagtgatagattagcgcttctccaagtc
cgatctatccttcagcaactaggtctaaacagcacctgcgatgacagtatcattgtaaag
gaggtgtgtggtgctgtatcaagaagggcagcgcaggtgtgcggggcaggcatggcagcg
gtcgtggataaaatccgagagaacaggggcttagaccatctggacgtcacagttggagtt
gatggaacattatataaattacatccacacttctccaaaatcatgcaccaaacagttaaa
gaccttgccccgaagtgcaacgtttctttcctcctctcggaggatgggagcggtaaagga
gcggctctgatcactgctgtggcctgcagactccgcagtagtgaacaaaattag

DBGET integrated database retrieval system