KEGG   Xenopus tropicalis (western clawed frog): 100127663
Entry
100127663         CDS       T01011                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor precursor
  KO
K04357  epidermal growth factor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
xtr04020  Calcium signaling pathway
xtr04068  FoxO signaling pathway
xtr04510  Focal adhesion
xtr04540  Gap junction
xtr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100127663 (egf)
   04012 ErbB signaling pathway
    100127663 (egf)
   04068 FoxO signaling pathway
    100127663 (egf)
   04020 Calcium signaling pathway
    100127663 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100127663 (egf)
   04540 Gap junction
    100127663 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100127663 (egf)
Cytokines and growth factors [BR:xtr04052]
 Growth factors
  Growth factors (RTK binding)
   100127663 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 SGL hEGF EGF_MSP1_1 GAPT
Other DBs
NCBI-GeneID: 100127663
NCBI-ProteinID: NP_001106478
Xenbase: XB-GENE-951823
UniProt: A8KBG4
LinkDB
Position
1
AA seq 1051 aa
MFFLLTALWPLVFDVLLLHTQGNKQWHCTGNPLPLDNERYACNTPVPFLIFSHGNDIFTI
NSDGTNLRKVVPSAGSTLQIDFIQQENRLYWLDQNRGFLQRMYLNGSKHERLRAVGKGSI
GFAIDWKHNVIFWANQQKGTIELTSRNEKRSRVLLRGLFNPKFVAIDPLEGLLFWSSNKS
WTIIQKATLDGSNVTSIIELSGALKGLTLDTDDKKIFWILSKIDREDSVIGSCSYNGDSV
MIVKNLRLSTKYHVLGVSLLYNHIYYSERKSGSIKVINKFTGKDIVSVNLKPSIMEIRNI
KVVYPVRSYSIPNSSSNQGAKSCSISNKHCTKTCEIDAENQKCHCMNGFVLSSNGRYCED
INECALWNHGCTLGCENIPGSYFCTCPEGYVLLPDNKTCHDKTPCLTEHIECSHGCVQTT
KGPLCTCPEGSVLSEDGKSCTGCTSPDNGGCSHICIMSGPGTWECDCFPGYNLQLDRKQC
LASGPRPYLMFANVHDIRRINFDGTNYESVLDSQIGRVFALDYDPVEDRMYFAHTALKCI
ESANMDGSDRKKMISGDLSTLEGLTVDAINRKLYWTDRGKSCIERSDLNGKYRKILIQEN
NIQPRGICVHPLAKKLFWTHVGANPRIESSDLEGSEREVIISKDLIWPSGITVDHLTDVI
YWCDAKKSVIESANLDGSNRQSFSQNDVGHPFAISVFEDHLWVSDWVQPSLIRIEKRNTQ
NWVRLRGNMQRPSSVVIVHPLAKPVIADDIPLPRKEKDSNNQTAHSESFFPGPLSTSNAE
MGTREAPSSRNGLLAEIMVSDDSGCIDIHCDINAHCVSSEDGPKCQCLEGFTGNGRLCHD
IDECSLHIAACNPHQTECIDTEGGYICKCKYGYIGNGLQCTDIDECSRGTHTCGENAVCT
NTEGNYTCTCTNGFPGSAADCTGKTIIRECPLAYDGYCLNGGVCIHFPELKDYGCRCVAG
YVGERCQFDDLKSWEKHVTQMKIHNVTIAVSLLLLLLILGLGSFAIYYYRHQMTHRKNHF
KQETAPGTTEKPICSTSGLSRSSEPGCLGKL
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgttttttttattgactgctctctggccattagtttttgatgtgcttttacttcatacc
caaggaaacaaacaatggcattgtacagggaatccacttcctttggataatgaacgctat
gcatgtaacactcctgtaccattcctgatttttagccacggcaatgacatttttaccatt
aacagtgatgggaccaatctcaggaaagtagtgccctctgcaggatccacactacaaata
gactttatccaacaagagaacagactttactggcttgatcaaaacagaggttttcttcaa
agaatgtacctgaatggctcgaagcatgagaggctacgtgctgtaggaaaagggtctatt
ggatttgcaattgactggaaacacaatgtcattttctgggctaaccaacagaaaggaaca
attgaactgacaagcagaaatgaaaaaagatctcgagtacttctgagaggtttatttaat
cccaagttcgttgctatcgatcctttggaagggcttctcttttggtcttctaacaaatca
tggactattattcaaaaagcaactctggatggaagtaatgtaacatctattattgaactg
agtggggcactaaaaggcctaacactggacacagatgacaagaagattttttggatcttg
tctaaaattgacagagaggattctgttattggctcttgttcatataatggtgactctgta
atgattgtcaagaatttgagactttcaacgaaatatcatgttttgggagtttctcttctc
tataatcatatctattattcagagaggaaatctggttccataaaagtaattaataaattc
acagggaaagatattgtttcagtcaacttgaagccatcaatcatggagattagaaatata
aaagtagtatatccagtgaggtcctatagtattccaaattcctcttccaaccaaggagca
aagtcgtgttccatttccaataaacactgtacaaaaacatgtgaaatagatgcagagaac
cagaagtgccattgtatgaatggttttgtcctcagttcaaatgggcgatattgtgaagat
ataaatgagtgtgccctatggaatcatgggtgtactcttggatgtgaaaatatcccaggt
tcctacttttgtacctgcccagaaggctatgttttacttccagacaataagacatgccat
gataaaactccttgcctgacagagcacatagaatgtagccatggctgtgtacaaacaacc
aaagggcctttgtgtacctgtccagaaggatcggtgctctctgaagatggaaagtcatgc
acagggtgcacctccccagataatggtggatgcagccatatttgcataatgtcaggacct
gggacttgggaatgtgactgttttccagggtacaacctacagttggacagaaaacaatgt
ttggcctcaggtcctcgcccatatttaatgtttgcaaatgttcatgacatcagacgaatt
aactttgatggaaccaattatgaaagtgtactcgactcacagatcggtagagtgtttgcc
ctggactatgacccagttgaagataggatgtactttgcacacacagctctgaagtgtata
gaaagtgcaaacatggatggcagtgaccggaagaaaatgatttctggagatctgagcaca
ctggaaggtcttactgttgatgcaattaataggaaactatactggactgaccgaggaaaa
tcatgcattgaaagaagtgatttaaatggaaaatacaggaaaatcctcattcaagaaaat
aacattcagccgagaggaatttgtgttcatccactggctaagaaattattttggactcat
gttggagccaaccctcgtatagagagttcggatttagaaggatcagaaagagaggttata
atcagtaaggacctgatctggcccagtggaatcacagtcgaccatctcactgatgttatt
tattggtgcgatgccaagaaatctgttatcgaatcagctaatctggatggctcaaatcgg
cagtcattttcccagaatgatgtaggccatccttttgccatatcggtctttgaggatcac
ttgtgggtctctgactgggtccagccatcacttataagaattgagaaaagaaacacccag
aactgggtacgtcttcgaggcaacatgcagagaccctcatctgttgtaattgtacatcct
ttggcaaagccagtcattgcagatgacatccccctgcctagaaaagagaaagacagcaac
aatcaaacagctcattctgaatctttttttcctggtccactttccaccagcaatgctgaa
atggggacgagagaagcaccaagtagcagaaatgggttgctggcagaaattatggtatca
gatgacagtggctgcattgatattcactgtgatatcaatgcacattgtgtctcatcagag
gatggcccaaaatgtcagtgtttggaaggcttcactgggaatgggaggttatgtcatgat
attgatgaatgttctcttcacattgctgcgtgcaatccccaccagacagaatgcattgat
acagaggggggttatatctgcaagtgcaagtatggctacattggaaatggacttcaatgt
acagatattgatgaatgcagtcggggaactcatacatgtggggaaaatgcagtgtgcacc
aatacagaagggaattacacctgcacatgcactaatggctttccaggaagcgcagccgac
tgtactggcaagacaataatcagagaatgtcccctggcttatgatggatactgtctcaat
ggaggagtgtgcatccatttcccagaactgaaagattacgggtgcagatgtgtcgcagga
tacgttggtgagagatgtcaatttgatgatctgaagtcttgggaaaaacatgttacccaa
atgaagattcacaacgttaccattgctgtttccttgctcttactcctactgatcctgggc
cttggctcctttgctatttattattacagacatcaaatgacccacagaaaaaaccatttt
aaacaagaaacagcaccgggcactacagaaaaacctatttgcagcacaagtggtctatca
agaagcagcgagcctgggtgtttagggaagctctga

DBGET integrated database retrieval system