KEGG   Xenopus tropicalis (western clawed frog): 100135094Help
Entry
100135094         CDS       T01011                                 

Gene name
ganc
Definition
(RefSeq) glucosidase, alpha; neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00052  Galactose metabolism
xtr00500  Starch and sucrose metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100135094 (ganc)
   00500 Starch and sucrose metabolism
    100135094 (ganc)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100135094 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 100135094
NCBI-ProteinID: NP_001107305
Xenbase: XB-GENE-5928423
UniProt: A9JRL0
LinkDB All DBs
Position
8
AA seq 918 aa AA seqDB search
MSSQEAALLTPHVSQTDVPVEGILTEDKKKFKTCSQIGFYRRQKLLLQGPSPYNADLEML
VVDNGIATLQIINQDTKVPLQVQIIPCKGIFRLKINEISPLKPRYEVPDVIVKDLAAERL
NVSQRESGCIVLENPNGAYKLHITAQPFSVSVTADDKLLLSLNSQGLLYFESLVSPQSKS
ATLESDSEVTKDEYGLWSETFGEFVDIKASGPASVGLDVSLHGFEYVYGLPEHADTHRLK
NTEHNDAYRLYNLDVFAYKTYDKMGTYGSVPLLLAHKPTQTCGLFWLNASETLVEINTRA
APQPSLSRSVPDTRKQRAIPQTEVRWMSESGIVDLFLLMGPSPQDVFRQYANLTGFQSLP
PLFSLGYHQCRWNYEDEADVEAVDLGFDLNNIPYDVIWLDIEHTDGKRYFTWDREKFCNP
TRMQEKLKQKKRKLVVISDPHIKVDPDYSLYSEAKARGYFVKDRGGQDFEGNCWPGTSCY
LDFTNPAVQDWYSAQYALDSYKDSTEVLFVWNDMNEPSVFDSPEMTMPKNAVHYKGWEHR
DLHNLYGFYQQMSTFKGLMQRSAGQERPFVLTRSFFAGSQRYGAVWTGDNKADWEYLKIS
VPMLLTLSVTGISFCGADVGGFVGDPEPELLIRWYQAGAFQPFFRAHAIQDSKRREPWLF
GEDNTLLIKKVIEERYTLLPFWYLLFYRAHVSAQPVMRPMWVEFPKHTESFEEETQYMLG
SALLVVPVLAPGVSSVDILFPGSGERWYDFRKYECVRGPHRKKVKVTLNEIPVFQRGGSI
IPLHTRVGRSTGWMDEFPYELRVALDSKGFAEGELFLDDGHSFNYIQENVFAHRKFAFQR
NVLSSSSADPKGKYQLKSIVERVHVMGVKKQPVEVNVHSSGVKTSVAFTYSAKLCLLSLE
SLSLCVSADWEIHIRDKL
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccaggaagctgccctgctgaccccgcatgtttctcagactgatgtacctgta
gagggcatccttactgaagacaagaaaaaattcaagacctgcagtcaaataggcttttac
aggcgacagaagcttctccttcaaggcccatcaccatacaatgctgatctggaaatgctc
gtagttgataatggtattgccactctccagatcattaaccaagacacaaaggttcctctt
caggtgcaaatcataccttgcaaaggcattttcaggctcaagatcaatgagatatctcca
ctgaagccaagatatgaggttcctgatgtgatagtaaaagatctggccgctgaaaggcta
aatgtgtcccagcgggaatctggttgcatcgttctggagaatccaaatggcgcttacaag
ctacacatcacagctcagccattttctgtctcagtaactgcagatgacaagcttctgctt
agtcttaattcccagggattgctgtattttgagagtctggtatccccacaatcaaaaagt
gcgactttagagagtgacagtgaagtgactaaggatgagtatggactttggagtgaaacc
tttggggaatttgtggacattaaggctagcggtccagcttctgttggcctggatgtttca
ctacatggatttgaatatgtgtatggtttgccagaacatgctgatacacacagactcaaa
aatacagagcacaatgacgcataccggctgtacaacttagatgtgtttgcatacaaaacc
tatgataagatgggaacatacggatctgtgccactgcttctagcacacaaacccacgcag
acatgtgggctattctggctcaatgcttcagagaccctggtagaaattaataccagggct
gccccgcagccttctttgtccagatctgtcccagatacacgcaagcagcgggccatccca
cagacagaagtgaggtggatgtctgaaagtggcattgtggatttgttcctgttaatggga
ccttcaccacaagacgtgttcagacagtatgcaaatctcacaggtttccagtccttacca
cctctgttttccttgggttaccaccagtgccggtggaactatgaggatgaagcagacgtg
gaagcagtggacttgggctttgatctaaacaatatcccttatgatgtcatctggttggac
attgagcacacagatggaaagaggtactttacctgggatcgtgaaaaattctgtaatcca
acgaggatgcaggagaagctgaaacagaagaaacgcaagctggttgtcatttcggatcct
catattaaggtagatccagactatagcctttattctgaagccaaggccagaggctacttt
gtcaaggacagaggtggacaagactttgaaggcaactgctggccaggcacatcatgttac
ttggactttacaaatcctgctgtacaagactggtactcagctcagtatgcacttgattcc
tataaagattctactgaggtcctctttgtttggaatgacatgaatgaaccatcagtgttc
gattccccagagatgaccatgccaaaaaatgctgtgcattacaaaggctgggaacacagg
gaccttcataacctttatggtttttaccagcaaatgtctaccttcaagggattgatgcag
cggtcagctggacaggagagaccctttgtactgacacggtcattctttgctggctcacag
agatatggtgcagtatggactggagataataaagcagactgggagtacttaaaaatatca
gtcccgatgctgcttacactgagtgtgactgggatttccttctgtggagctgatgttgga
gggtttgttggagacccagagccagaactccttattcgatggtaccaggccggcgcattt
cagccctttttccgtgcacatgccattcaagacagcaaaagacgtgagccctggctattt
ggggaagataacacattgctgataaagaaagtgatagaggagagatatactctgcttcca
ttctggtacctgctcttttaccgagcccatgtgtctgcccagccggtgatgaggcctatg
tgggtagaattccccaagcatactgaaagctttgaagaagagacacagtacatgttagga
agtgccctgctggttgtgccagtgttagcgccaggagtgtcttcagtggatattctgttt
cctgggtctggagagcgctggtatgactttagaaaatatgagtgtgtaaggggcccccac
agaaagaaagtgaaagttacattaaacgagatcccagtgtttcagcgtggaggctcaatt
attccactgcatacaagggttgggagatccacaggctggatggatgaatttccttatgag
ctacgagtagctctggattcaaagggctttgctgaaggggagctgtttttggatgatggc
cattcttttaactatatccaggagaatgtgttcgctcatcggaagtttgctttccaaaga
aatgtcctttcatccagttctgctgatccaaagggaaaatatcagttgaagtccattgtg
gagagggtgcatgtaatgggtgttaagaaacaaccagtggaagtcaatgtgcacagttca
ggagtcaagacaagtgtggcttttacctacagtgccaaactctgtctcctgagcctggaa
tcactctccttgtgcgtgtccgctgactgggagatccacatcagagacaagttataa

DBGET integrated database retrieval system