KEGG   Xenopus tropicalis (western clawed frog): 100135183Help
Entry
100135183         CDS       T01011                                 

Gene name
slc51a, osta
Definition
(RefSeq) organic solute transporter subunit alpha
  KO
K14360  organic solute transporter subunit alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100135183 (slc51a)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC51: Transporter of steroid-derived molecules
   100135183 (slc51a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Solute_trans_a
Motif
Other DBs
NCBI-GeneID: 100135183
NCBI-ProteinID: NP_001107358
Xenbase: XB-GENE-5838770
UniProt: A9ULC7 B7ZTY7
LinkDB All DBs
Position
2
AA seq 260 aa AA seqDB search
MMIATTSCFGMWIPRSTMFTDFTASVFLAVLIHKFQLMLVNECGGRREFLSTFGDTKLKI
STGPFCCCCLCLPHKDINRKTLFILKLGTFQFAFLRPVLMFLAVVLWTNGTYMIGNSSAE
KATIWINIGVGITTITALWAVGIMFNLVKDNLKEKNIIGKFAVYQFTVILSQLQTSIINI
LGTTGVISCVPPLPGPSRASYMNQQLLIMEMFLVTVICRVLYRRRYDDKNLLENQETNDN
LRNSMMHLNGKALEDGPQSV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgcaacaacatcctgctttggaatgtggattccacgtagcaccatgtttact
gacttcactgcttctgtgttccttgcagtgttaatacacaagtttcagctcatgctggta
aatgaatgtgggggaagaagagaatttctctcaacatttggtgatacgaagctgaagatt
agcactggccccttctgctgctgttgcctgtgcctgccacacaaagacatcaacagaaag
actttattcatcctgaagctgggtacatttcagtttgccttcctacggccggtgcttatg
tttctggctgtggttctttggacaaatggaacttatatgattggtaattcatctgcagaa
aaagctactatctggattaatattggagttggtattaccacaataacagccctttgggca
gtgggaattatgtttaatctagtaaaggacaacttaaaggagaaaaatatcattggcaaa
tttgcagtctatcagtttacagtcattttgagccaactgcaaacctcaatcattaatatt
cttggtacaaccggtgtcatctcttgtgttcctcctctcccggggccatcacgggcttcc
tacatgaaccagcagcttctcattatggaaatgttcctggtcacagtcatctgccgagtg
ctgtaccggaggagatatgatgataaaaatcttttggaaaaccaagagaccaatgataat
ttacgaaacagcatgatgcatctgaatggcaaagctttggaagatggaccccaaagtgtt
taa

DBGET integrated database retrieval system