KEGG   Xenopus tropicalis (western clawed frog): 100144961Help
Entry
100144961         CDS       T01011                                 

Gene name
tspo, bzrp, dbi, ibp, mbr, mdrc, pbr, pk18, pkbs, ptbr
Definition
(RefSeq) translocator protein
  KO
K05770  translocator protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100144961 (tspo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100144961 (tspo)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   100144961 (tspo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TspO_MBR
Motif
Other DBs
NCBI-GeneID: 100144961
NCBI-ProteinID: NP_001120003
Xenbase: XB-GENE-5863588
UniProt: B0BM41
LinkDB All DBs
Position
Un
AA seq 162 aa AA seqDB search
MPSWAPAIGLTILPHVGGIAGGLITRQEVKTWYTTLVKPSWRPPNWMFGPVWTTLYTSMG
YGSYLIYKELGGLNENAVVPLGLYASQLALNWAWTPIFFGAHKIGWGLVDLLLLWGAAAA
TTISWYPISRPAAYLMLPYLAWLTLASALNYRIWKDNKDKSE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctgggcccccgccatcggcctcaccatcctcccccacgtgggcggcattgcc
ggggggttaataacgcggcaagaggttaaaacctggtacacgaccctggtgaaaccctcc
tggcgcccccccaactggatgtttggccctgtgtggaccacattatatacctccatgggc
tatggctcctacctgatctacaaggaactgggagggctgaatgagaatgccgtggtgcct
ctcggactctacgccagccagctggcactcaactgggcatggactcccatattctttggg
gcccacaagatcggctggggactggttgatctacttctcctctggggggccgccgctgcc
acaacgatatcctggtaccctatcagccggccggcggcgtatctgatgctcccctacctg
gcgtggctcaccttggcctctgccctcaactaccgcatctggaaggacaacaaggacaag
agcgagtag

DBGET integrated database retrieval system