KEGG   Xenopus tropicalis (western clawed frog): 100145270
Entry
100145270         CDS       T01011                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04210  Apoptosis
xtr04620  Toll-like receptor signaling pathway
xtr04621  NOD-like receptor signaling pathway
xtr04622  RIG-I-like receptor signaling pathway
xtr04623  Cytosolic DNA-sensing pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04920  Adipocytokine signaling pathway
xtr05132  Salmonella infection
xtr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100145270 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100145270 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100145270 (ikbkg)
   04621 NOD-like receptor signaling pathway
    100145270 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    100145270 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    100145270 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    100145270 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100145270 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100145270 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100145270 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100145270 (ikbkg)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100145270 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO DMPK_coil ZapB
Other DBs
NCBI-GeneID: 100145270
NCBI-ProteinID: NP_001120221
Xenbase: XB-GENE-979184
UniProt: B0K002
LinkDB
Position
8
AA seq 506 aa
MVQPKESSAAEYNPCEGGPGDTSLGKPEVLPPELTSNEAFQRIWAENHDLRAALEQSNMM
LRKGHGDMLEFQDSQRKEREFITYKFGEARDLVLRLTNERNSLQAQLEEAMKQLAEVREV
KSRGSTENEQGRLEDTILTDRRSPRKAYEEQKENGNKEVCMENEIMQGTVDRNSRTEQEF
QKKLQDAEARNTQFLRQIADLQEEVSKLRRQVVEKGEESQKQLQSLQLQMEQLSEERNSV
KAQVTSLLGELKESQTSLEICLQEKRKVEDSLRSALEEKKGWEAQVKQQVVQLDQRMMQV
QNLETALKMERQNATDEKRKLAQLQVAYHTLFQEYDTHIKVSMQQAKHTKGVDLQIQELK
QQLQEAEEALVAKQALIDKLKDEAEKQRTELDTVPVLKAQVEIYRADFLAERKAREELHA
EKERLQEQLNVLLQERLSNRAMIDEMRNRHSDTLRPTLPHGPSLYPLQPAMPFQPEVEPP
DFSCPKCFYKAPDMDTLQIHVMDCIQ
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggtgcagcccaaagagagctctgccgctgaatacaacccatgtgaggggggcccaggg
gacacatccctggggaagcctgaagttcttcctcctgaactgaccagtaacgaagccttt
caacgtatatgggcagaaaaccatgacctgagagctgctctagaacagagcaacatgatg
ttacgcaaaggacatggcgacatgctggagtttcaggattcgcagagaaaggagagagag
ttcatcacatacaagtttggtgaggcgcgggacctggtgctgaggcttaccaatgagcga
aactccctgcaggcgcagctggaagaagccatgaagcagctggcagaggtgagagaagtg
aagagtcgagggagcacagagaatgagcaggggcggctggaggataccattctgactgac
cgaagatccccaaggaaagcgtatgaggaacagaaagaaaatggcaacaaggaagtttgt
atggaaaatgaaatcatgcaaggaactgtggaccggaactctagaactgagcaggaattt
cagaagaaactgcaggacgctgaagccaggaatactcagtttctgcgtcagattgcagat
ctacaagaggaagtatctaagcttaggcgccaggtggttgaaaaaggagaggaatctcaa
aagcaactgcaaagtttgcaactgcagatggagcaactgtctgaggagaggaattcagta
aaagcccaggtgacctctctattgggggagctgaaagagagtcagacaagtctggagatc
tgcctgcaggaaaagagaaaggtagaggacagcctccgtagtgccctggaggagaaaaag
ggctgggaagcccaagtgaagcaacaggttgtgcagcttgatcagcgaatgatgcaagta
cagaatttggaaacagcgttaaaaatggaaagacaaaatgccacagacgagaagaggaaa
ctggcacagcttcaggttgcatatcacacgctcttccaggaatatgacacacatatcaag
gtcagcatgcagcaagccaagcacaccaagggagtggacctgcagatccaggagctgaag
cagcagctgcaagaggcagaggaagctctggttgccaaacaagcactgattgataaatta
aaggatgaggcagagaaacagaggactgaattagacactgtgccagtgctgaaagcacag
gtggagatataccgggctgactttctggcagagcgaaaagcacgcgaggagctgcatgca
gagaaggagaggttgcaggaacaactgaatgttctactgcaagagaggctgagcaatagg
gcaatgattgatgagatgaggaacaggcactctgatacccttcgccccaccttgccccat
ggcccatccctgtacccccttcagcccgccatgcctttccaaccggaggtcgaaccgcca
gacttcagctgccccaagtgcttttataaagcaccagatatggacaccctacagatacac
gttatggattgtatacagtaa

DBGET integrated database retrieval system