KEGG   Xenopus tropicalis (western clawed frog): 100145475Help
Entry
100145475         CDS       T01011                                 

Gene name
tgm6
Definition
(RefSeq) transglutaminase 6
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100145475 (tgm6)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100145475 (tgm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 100145475
NCBI-ProteinID: NP_001120399
Xenbase: XB-GENE-5878274
UniProt: B1H2S4
LinkDB All DBs
Position
10
AA seq 703 aa AA seqDB search
MRSDPQVIACDWYYAVNEKAHHTDVYESDDLVLRRGQPFKLTLMLNRPLQAEENILFIFE
TGPSPSETSKTKVVFPLFRAENLQSWGAILTSIKSTSITVTINSHSDAVIGRYILSVAVQ
CRGSDKPLPHQIGALNLLFNPWLQGDAVFMAEEDQRQEYVMNEQGVIFQGSDEDITSINW
EYNQFERNILDICLVILDRSQNYKKDPALDVSQRNDPLYVCRVLSAMLNSKGDDGVLEEN
WSDDYINGASPSSWNGSMNILKSWYYSKFKPVKYGQCWVYAGMLCTVLRSLGIPTRVITH
FNSGQDKNANLFIDLQYKSQGSRQNDQEDQLWNFHVWNEAYFKRRDLGKSYNGWQVIDST
PLKRSDGVYQCGPAPLTAIKEGDINLNYDVKYMFASVNADVACWIYYRNGTKKQVSNNAK
ETGKFISTKAIGSNDRVDVTNNYKYAKGSEKEIKVFEKALKLSKGSFVGRTREKPRGGNI
LFGRCTLDQIATFGQDFNLILSLKNLTPDSINVTVYINTSAILYTGRQRHTIWTGGKFLS
LGPNLEKRFSIPVKYGQYSKHMTDNGVICMTALCEVEGTEERILVERNVSLVKPPLSITL
PDKAIINQESNANIVIVNPLLETLNSCILWVEGYGLTDKILKKEVPSLKPGQSSEHNFVI
TPMKTGVRTLLVNFSCDKIQNMKGSGKILITYSQEVSDSPVPT
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcagaccctcaggtcatcgcctgtgactggtattatgcagtcaatgaaaaggcc
caccatacagatgtctatgagagcgatgatctggtgctcaggagaggacaacctttcaag
cttactctcatgctcaaccgacctctacaagcagaggaaaacattttgtttatcttcgaa
acaggtccatccccatcagagacttcgaaaacaaaagttgtgttcccattgtttagggcc
gagaatctacaatcatggggagccattttgacatccataaagtcaacgtcgatcacagtg
accataaacagtcattctgatgctgtgattgggcgctatattctaagtgtagctgttcag
tgccgaggatcagacaagccacttccacatcaaattggggcccttaatcttctcttcaat
ccatggctacaaggagatgcagtgttcatggctgaagaggatcagcgtcaggaatatgtt
atgaatgaacagggagttatctttcaagggagtgatgaagacataacatctattaactgg
gaatataatcagtttgaaagaaacatacttgatatttgcttggttatcctggaccgcagt
caaaactataagaaagaccctgctctggacgtctcgcagagaaatgacccactgtatgtg
tgcagagttctcagtgctatgttgaacagtaagggtgatgacggtgtcctggaggagaac
tggagtgatgactatataaatggggcgagcccatccagttggaatggcagtatgaacatt
ctgaaaagctggtattacagtaaattcaaacctgtaaagtatggtcagtgctgggtgtat
gcaggaatgctctgcacagtgctccggagcttggggattccaacaagggtaataacacac
ttcaactcaggccaagacaagaacgccaatctgttcattgatttacaatacaaaagccaa
ggaagcagacaaaatgatcaagaggatcagctgtggaatttccatgtttggaatgaggcc
tatttcaaacgcagagatttagggaaatcatataatgggtggcaggtaatagattcaact
ccactaaaaagaagtgatggagtttatcaatgtggcccagctcctctaactgccattaaa
gaaggggatatcaatcttaactatgatgtaaaatacatgtttgcgtcagtcaatgccgat
gttgcctgctggatctactaccgtaatgggacaaagaaacaggtttccaacaatgccaag
gagaccggcaaatttattagcacaaaggccataggaagtaacgacagagtggatgtcaca
aataattacaaatatgccaaaggatctgaaaaggaaataaaagtctttgaaaaggctctg
aagctgtctaaaggttccttcgtgggaaggaccagggagaagccacgaggaggaaatata
ttatttggaagatgtacactggaccaaatagctacttttggccaagattttaatcttata
ctaagccttaaaaacctgactcctgacagcattaacgtaactgtgtatataaacacttca
gcaattctctacactggacgacagagacatacgatctggacaggtggaaagtttctcagc
ctaggtcctaatttagaaaaacgattttcaattccagtaaaatatggccagtatagtaaa
catatgactgacaacggtgtgatatgcatgacagccctatgtgaggtggaggggacagaa
gaaaggattttggttgaaaggaatgtctcattggttaagcctcctcttagcatcacgctt
cctgataaggccatcataaaccaagaatccaatgcaaatattgtgattgtcaacccttta
ttggaaaccctgaactcctgcattttgtgggttgaaggatatggcctaactgacaaaata
cttaagaaagaggtcccgtcgctcaaacctggacaatcaagtgaacataattttgtgatc
acccctatgaagacaggtgttaggacgttgcttgtgaacttctcctgcgacaagatacaa
aacatgaaaggatctggtaaaatcctcataacttacagtcaggaagtctcagacagccct
gtacctacttga

DBGET integrated database retrieval system