KEGG   Xenopus tropicalis (western clawed frog): 100145511Help
Entry
100145511         CDS       T01011                                 

Gene name
gad1.2, cpsq1, gad, scp
Definition
(RefSeq) glutamate decarboxylase 1 (brain, 67kDa), gene 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00250  Alanine, aspartate and glutamate metabolism
xtr00410  beta-Alanine metabolism
xtr00430  Taurine and hypotaurine metabolism
xtr00650  Butanoate metabolism
xtr01100  Metabolic pathways
Module
xtr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100145511 (gad1.2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100145511 (gad1.2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100145511 (gad1.2)
   00430 Taurine and hypotaurine metabolism
    100145511 (gad1.2)
Enzymes [BR:xtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100145511 (gad1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100145511
NCBI-ProteinID: NP_001120426
Xenbase: XB-GENE-5830282
UniProt: B1H2Y8
LinkDB All DBs
Position
6
AA seq 542 aa AA seqDB search
MEKVGTCADEGNSQPKLLHEKHICQEKANEERIMHSEKYISDFSNIYSTDLLPTRNGEKC
TEQFLIEVLRILLNHIKKTYDGESKVLDFHHPHQLLEGLEGFNLELSDQPEPLEQILVDC
SDTLKYSIKTGHPRYFNQLSCGLDIIGLAGEWLTATANTNMFTYEIAPVFIIMEEIVLKK
MQEIIGWGENEADGIFSPGGTISNLYSLQAARYKYFPMVKTKGMAALPQIVIFTSEQSHY
SFKKASAILGIGTDNVIAIKCDERGKMIPSDLEDKILKAKRQGQHPFYVSATAGTTVYGA
FDPLITIADICKRYGLWMHVDAAWGGGLLLSKKHRYKMNGIERANSVTWNPHKIMGVPLQ
CSAILIRQKGLLQACNQQCADYLFQMDKPYDTAYDTGDKTIQCGRHVDIFKLWLMWKAKG
SCGFELQINRCLELSEYLYNKLQSKSNFELVFRDKPEYTNVCFWYIPPSLEHVPRDKEWK
ARLHKIAPQIKARMMEEGTVMVSYQPQGDKPNFFRMVFSNPASKKSDVDFLLEEIERLGK
GL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttggtacatgtgcagatgaaggaaatagtcagcccaagctactccatgaa
aaacacatttgtcaagagaaggccaatgaagagaggataatgcacagtgaaaaatatatt
tctgatttctcaaacatttattccacagacctactccctacaagaaatggagaaaagtgc
acagaacaatttttaattgaagttttacgtattcttttgaatcacataaaaaaaacctac
gatggggaaagtaaagttcttgacttccatcatccacaccagctactagaaggattagaa
ggatttaatttggaattatctgaccagccagagcctttagagcaaattcttgtggattgt
agtgatactcttaaatacagcattaaaacaggacatccacgttactttaatcagctctcc
tgtggccttgatataattggactagctggtgaatggctgactgcaactgctaatacaaac
atgtttacatatgaaattgcaccagtgtttataatcatggaagaaattgtgctgaaaaaa
atgcaagagattattggatggggagaaaatgaagcagatggtatattctctcctggtgga
acaatttccaacctttatagccttcaagcagctcgttacaaatattttcccatggtgaaa
acaaaaggaatggcagcacttccacagattgttatttttacatctgaacagagtcactac
tcatttaaaaaagcatctgcaattcttggtattggaactgacaatgtcattgcaataaag
tgtgatgaaaggggtaaaatgattccatctgacttggaagataaaattctgaaagcaaaa
agacaaggacaacatccattttatgttagtgctacagctgggacaacagtatatggtgca
tttgatcccctcatcactattgctgacatttgtaagagatatggactctggatgcatgtt
gatgcagcctggggtggtggattactgttgtccaaaaaacatcgctataaaatgaatgga
attgagagagctaattctgtcacttggaatccccacaaaattatgggagtcccactacaa
tgctcagcaatccttattcgacaaaagggtcttctgcaggcatgtaaccagcaatgtgca
gattatctcttccaaatggacaaaccttacgatacagcttatgatacaggagacaagaca
atccagtgtggccgacatgtggatatctttaaactctggttaatgtggaaggcaaaggga
agctgtggctttgaacttcaaataaacagatgccttgaactttcagaatatttgtacaat
aagctacaatcaaaatcaaattttgaacttgtcttccgtgataagccggagtacacaaat
gtctgcttctggtatattccacctagtctggaacatgtcccaagagataaggaatggaaa
gcaaggctgcataagattgctccgcagattaaagcccgtatgatggaagaaggaacagtt
atggtcagttaccagcctcaaggagacaaacctaactttttcaggatggttttctcaaat
ccagcttctaaaaaatctgatgttgattttcttctcgaagaaattgaaagattaggaaaa
ggcttgtga

DBGET integrated database retrieval system