KEGG   Xenopus tropicalis (western clawed frog): 100145591Help
Entry
100145591         CDS       T01011                                 

Gene name
gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00350  Tyrosine metabolism
xtr01100  Metabolic pathways
Module
xtr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100145591 (gstz1)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100145591 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100145591
NCBI-ProteinID: XP_002938913
Xenbase: XB-GENE-978910
LinkDB All DBs
Position
8
AA seq 216 aa AA seqDB search
MAALGKPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQV
PALCIDGVTLSQSLAIIEYLEETRPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVL
QKIGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDL
APYPTIVGINESLLQLEAFQVSHPSCQPDTPEELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgggaaagcctctcctgtatggatactttcgcagttcttgctcatggaga
gtacggatagctctggctttcaagggcattgagtatgatcagcaggtcattaatttagtc
aaagatggtggaatgcagttatctaatgaatacaagcaggtgaatcctatgcagcaggtg
ccagctctgtgcattgatggcgtgactctgagccaatcgcttgcaataattgaatatctt
gaggaaactcgccctaacccacctctacttccacgtgatcccaagaaacgggcacaggtt
cgcatgatcagtgaccagattgcatcagggatccagcctttgcagaatctctgtgttctg
cagaaaattggagagacaaagctggaatgggcaaagcatttcatcacacgtggctttcaa
gctttggaaaagttgctgcagaccaccgctggacgttattgcgtgggagatgaggtgacc
atagctgatctgtgtcttgttccacaagtggcaaatgctgtcaggttcaaggttgacctt
gccccctatcccacaattgtggggataaatgagtctctactacagctggaagcttttcag
gtcagccacccatcttgccagcctgatacaccggaggaactcagagcataa

DBGET integrated database retrieval system