KEGG   Xenopus tropicalis (western clawed frog): 100145748Help
Entry
100145748         CDS       T01011                                 

Gene name
kmt5c, suv420h2
Definition
(RefSeq) lysine (K)-specific methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100145748 (kmt5c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    100145748 (kmt5c)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100145748 (kmt5c)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100145748 (kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET CNTF Trehalase
Motif
Other DBs
NCBI-GeneID: 100145748
NCBI-ProteinID: NP_001120591
Xenbase: XB-GENE-6459063
UniProt: B1WB46
LinkDB All DBs
Position
7
AA seq 772 aa AA seqDB search
MGSNRLTARELCENDDLATSLVLDPYLGFRTHKMNVSAMPTIRRQHHLREALQTFRKKKD
LEAAYHSLAAGEWARHYFQSRTRQQESLLKTHIFRYLRMFLPESGFMILSCCRYSLETNG
AKVVSTKAWCKNEKIELLVGCIAELSKADETLLRFGDNDFSVMYSTRKKCAQLWLGPAAF
INHDCRPNCKFVPTEGNTACVKVLREIKSGEEITCFYGDSFFGEKNELCECCTCERKGEG
AFKQQKTEQTVSTSLEKYQLRETDGRLNRLSESACKQSQQVTARRKKDPPGELSGFPSIG
SRVRLSLRLKRIPASRRKRAFYRRLRTLASSRYFYSSRLVKHIPSKPVKIALPQGTVLRD
VRIILHNCKKCNMASHPKHQHDGQCCKLGKEPLVSLRREDLSPEKLKFRLSCHGGSCSPT
IQTANIECNAKDCPLPEAEKASAEQVTSAEVCEHLSFSPVPSLSGDDHSFYEPEIPASLL
GPDSPSAEPLVKEPLSSVCPPPTVYPHNNNNGDIMSALHHQALKQFGITHYIKVGLSKDV
RSLEKSGKNPADSSSLAAEPSDNCIHSQHPVTSDDRLAGNLTDETQGNPVSSPAKTQRCE
ALNGSLAPKLFSLRSRPVSFKASETSDNKITLFKRSSSSSAKPGVQYVKLNGHVKLTGQL
VPSEPHAPNAARARPLADTMRSDPKLLLKPYVELGLNNNLKRHSVTGLPPSAVLTEEAFN
KLHSSPASKQLAEGAKKKVAFNPFTPSKRLRLVVSHGSIALDIASTSSEETA
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaaatcgcttgacggccagagaactttgtgagaatgatgacctcgcgacgagc
ctggtgcttgacccttacctggggtttcggactcataaaatgaatgtcagtgccatgccc
actatacggaggcagcatcacctgcgggaggctctgcaaacattccgtaagaaaaaggac
ctggaagctgcatatcactccctagcagcaggggaatgggctcgtcattacttccaaagc
cggacccggcaacaggagagtctgctaaagacacatatattccgatatctccgaatgttt
cttccagagagtggattcatgattctctcctgttgtcggtactctctagaaaccaacgga
gcaaaagtggtctctacgaaggcatggtgcaagaatgaaaagattgagctcctggtgggg
tgcatcgctgaactaagcaaagcagacgagaccctgctccgttttggagataatgatttt
agcgtcatgtactccactcggaaaaagtgtgcacagctctggctagggccggctgccttc
atcaaccacgactgtcggccaaactgcaagtttgtaccaacagagggaaacaccgcttgt
gtaaaggttctcagggaaatcaaatcaggcgaagagatcacatgcttctatggagacagc
ttttttggagagaaaaatgaattgtgtgaatgttgcacttgtgaaagaaaaggggagggt
gcttttaagcagcaaaaaacagagcagaccgtatctacctcattagaaaaataccagctc
cgtgagacagacggccgcttaaatcggctgagtgagagcgcctgcaagcaatcccagcaa
gtgactgcaaggagaaagaaggatccaccgggtgagttatcgggatttccctctataggt
tcaagagtccggctatcactcagactgaaaaggatcccagcaagccgcaggaagagagct
ttctatcggagactcaggactctggcttcatcccgctatttttattcatcccgcctagtg
aagcacattccctctaagcctgtgaagattgcactgccccaggggactgtcttaagggac
gtgcgtatcattctgcataactgcaaaaaatgtaatatggcctcccatcctaaacaccag
catgatgggcaatgctgcaagctaggaaaagagcctttggtgtcgcttcgccgggaagac
ctcagccctgaaaaactaaaattccgattaagctgccacggaggttcatgctctcctacc
atccagactgctaatatagagtgcaatgccaaagattgtcctttgcccgaagcagaaaag
gccagcgcggaacaggtcacgtcagccgaagtgtgtgagcacttgtctttctcccccgtg
ccgagtctcagtggagatgaccactctttctatgagcccgaaatccctgcttcattgctg
gggcctgacagtccatctgctgaacccttagtaaaagaacccttgtccagtgtatgtcct
cctcctactgtgtatcctcataataataataatggcgacataatgtcagcgttgcatcat
caagcactaaaacagtttgggataacgcattatattaaagttggtttaagtaaagatgta
agatctttggaaaaatctggaaagaatccagcagatagcagttccttggcagcagagccc
agtgataattgtatacattctcagcaccctgttacatcagatgaccgcctagcgggtaat
ttgactgatgaaacacagggtaacccagtaagttcccctgcaaagacacagagatgcgaa
gccttaaatgggtcactggcacctaaacttttctctttaagatccagaccagtatcgttt
aaagcaagcgagacttcagataataagatcaccctattcaaaagaagtagtagtagttcg
gcaaagccaggggtccaatatgtaaaactgaacggacatgtaaagttgacaggtcagctt
gttcctagtgaaccccatgcaccaaatgcggctagagccaggcccctggccgacacaatg
cgttctgaccccaaattgttgctaaagccatacgtagagttgggactcaacaacaactta
aagagacactcggtcaccgggctcccccctagcgcggttttaacagaagaagcctttaac
aaattgcacagctcgccggcgtctaaacaactggcggaaggcgcaaagaaaaaagtggca
tttaatccattcactccctccaagagactgcggctcgtggtcagccacggttccattgct
cttgacattgcatccacatcgagcgaagaaaccgcttaa

DBGET integrated database retrieval system