KEGG   Xenopus tropicalis (western clawed frog): 100170458Help
Entry
100170458         CDS       T01011                                 

Gene name
nme6, NM23-X6
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr00240  Pyrimidine metabolism
xtr00983  Drug metabolism - other enzymes
xtr01100  Metabolic pathways
Module
xtr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
xtr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
xtr_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100170458 (nme6)
   00240 Pyrimidine metabolism
    100170458 (nme6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100170458 (nme6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100170458 (nme6)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     100170458 (nme6)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100170458 (nme6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 100170458
NCBI-ProteinID: NP_001123709
Xenbase: XB-GENE-969918
UniProt: B3DL53
LinkDB All DBs
Position
3
AA seq 179 aa AA seqDB search
MSSFRWVRPLQLTLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYC
EHKGRFFYQRLVEFMSSGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGL
TDTRNTTHGSDSVESACREITFFFPEFNTSDWYEKQEPRYRTGPVFYDEERSEHRLEGE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatttcgctgggttcgaccccttcagctcacgttagcgttgattaaacctgat
gctgtagccaatccagtcatttctgaggcggtacatcaaaagattttagaaaataacttt
ctgatcataagacataaagagcttcattggagatccacagattctcagaggttttattgt
gagcacaagggacgatttttctatcaacgactagttgagtttatgtcaagtggacccatg
caggcatatattctggcacatgaggatgctgtccagttatggaggaacttaatgggtcca
accaaagtgttcagagcacgaattgtggctcctgggactgtgcggggagatctgggacta
actgacacccgtaataccacacatggttctgattctgttgaatcagcttgccgtgaaatc
acattttttttccctgagttcaacactagcgattggtatgagaagcaagaacctcgctac
agaacagggccagtgttctatgatgaagaacggtcagaacaccgacttgaaggggagtga

DBGET integrated database retrieval system