KEGG   Xenopus tropicalis (western clawed frog): 100170579Help
Entry
100170579         CDS       T01011                                 

Gene name
snx27
Definition
(RefSeq) sorting nexin family member 27
  KO
K17936  sorting nexin-27
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100170579 (snx27)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100170579 (snx27)
Membrane trafficking [BR:xtr04131]
 Protein recycling
  Others
   Others
    100170579 (snx27)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   100170579 (snx27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PDZ_6 PDZ RA PDZ_2 USP7_C2 RBD
Motif
Other DBs
NCBI-GeneID: 100170579
NCBI-ProteinID: XP_002941514
Xenbase: XB-GENE-959088
LinkDB All DBs
Position
Un
AA seq 389 aa AA seqDB search
MADEDGDGIHSGQRNGGGGFGSVGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELY
APLQHVSAVLPGGAADRAGIRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELVLTVLSV
PPHEAENLDPSDDSSGQSFYDYTEKQAVPISIPTYKHVEQNGEKFVVYNVYMAGRQLCSK
RYREFAILNQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGES
DIMQEFLSESDENYNGVSDVELRIALPDKSTVTVRVKKNSTTDQVYQALTAKIGMDGITA
NYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTVRKWLFTTSEEALLKDNDL
AVSFFFHQVNKASVESGSYWDLALGFGAQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggacggggatgggatccattctgggcagcggaatgggggcggagggttt
ggctctgtcgggggccccagggtggtccggatagtcaagtccgagtccggctatggcttc
aatgtccgcggccaggtcagtgagggcggccaactgcgcagcatcaacggggaactctat
gcgcccctccagcatgtcagcgccgtcctacccgggggagccgccgatcgagccgggatc
cgcaagggggaccgcatcctggaggtgaatggggtgaacgtggaaggggccacccacaag
caagtcgtggatctgatccgggccggggagaaggagctggttctgacggtcctgtcggtt
ccgccccacgaggcggagaatctggatcccagcgacgactcctccgggcagtcgttctac
gattacaccgagaagcaggcggtgcccatctccatccccacctacaaacacgtggagcag
aacggggagaagtttgtggtgtataacgtgtacatggccggccggcagctctgctccaag
cggtaccgggaattcgccatcctcaaccagaacctgaaacgggagtttgccaacttcacc
ttcccccggctgcccgggaagtggccattctccctatcggagcagcaactggacgcgcgc
cggaggggcctggaggagtatttggaaaaagtgtgctccatacgtgtcataggggagagt
gacatcatgcaggagttcctgtccgagtccgacgagaattacaacggggtatctgacgtg
gagctgcgaatcgccttaccggacaaatccacggtaaccgtgagggtcaagaagaatagt
acgacggaccaggtgtaccaggccctcaccgccaagattgggatggacggaattacagcc
aattactttgcactcttcgaagtcattaatcactcctttgtcaggaagttggcccccaac
gagttcccccacaagctctatgtacagaactacacctcggccgttcccgggacttgcctc
actgtcaggaaatggctcttcacaacctcagaagaggctctactgaaggacaatgacttg
gccgtctctttcttcttccaccaggtaaacaaagcaagtgtggagagtgggtcttattgg
gacttggcattggggtttggggcccaatga

DBGET integrated database retrieval system