KEGG   Xenopus tropicalis (western clawed frog): 100216137Help
Entry
100216137         CDS       T01011                                 

Gene name
slc30a9, gac63, huel, znt-9, znt9
Definition
(RefSeq) solute carrier family 30 (zinc transporter), member 9
  KO
K14696  solute carrier family 30 (zinc transporter), member 9
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100216137 (slc30a9)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC30: Zinc efflux transporter
   100216137 (slc30a9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_efflux XPA_C
Motif
Other DBs
NCBI-GeneID: 100216137
NCBI-ProteinID: NP_001135585
Xenbase: XB-GENE-976698
UniProt: B4F723
LinkDB All DBs
Position
1
AA seq 360 aa AA seqDB search
MAGIYARSWPSLCRLYSRCAGVRSSGGRFCHGWQNALESKGLLYFLPSSYLPIQAQIRLY
SSGDQKEDHGPKGPSAASSQEKSTAGLDSSKSEQKSTFPPDPIQVKVKAVLKKREYGTKY
MKNNFITGVRALNEFCLKPSDLESLRKIRRRSPHDDTEAFTVYLRSDVEAKAYEVWGSPE
AIFRERKMRKEEEIAYRENLFKNQKLLKEYKDFLGNTKPRLSTSNMFMKGPGKVVMVAIC
INGLNFFFKLLAWVYTGSASMFSEALHSLADTLNQALLALGISQSVRTPDPGHPYGFTNM
RYIASLISGVGIFMMGAGLSWYHGIMGLLHPQPIESLLWAYCILAGSLVSEGALNKLSCL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccgggatatacgcccggagctggccctcactatgccggctgtactcgcgttgtgcc
ggggtgaggtctagcggtgggcgcttctgccacggttggcaaaatgctctggagagcaaa
ggacttctgtattttctgccatcaagctacctgcctattcaagcacaaatccgactttat
tcttccggtgatcagaaggaagaccatggaccaaaagggcccagtgcagcaagttcccaa
gaaaaatctacagcaggactggattctagcaaatctgaacaaaaaagtactttcccaccg
gatcctattcaagttaaagtaaaggcagtcttaaagaagagagagtatgggacaaagtac
atgaagaataacttcatcacaggggtaagagctctgaatgagttctgcctaaagcccagt
gacttggagtcattacggaaaatcaggcgaagaagtccccatgatgatactgaagcattt
actgtatatctgaggtctgatgtggaggcaaaagcctacgaggtatggggaagtccagaa
gccattttcagggaacggaaaatgagaaaagaggaagagattgcatatagagaaaattta
tttaagaaccagaaactgttaaaggagtacaaagactttctagggaacaccaagcctcgg
ttaagtacatccaacatgttcatgaaaggacctggaaaggttgtgatggttgcaatttgt
ataaatgggttaaacttcttttttaagctgctagcatgggtgtacacgggttcggcaagc
atgttttcagaagccctccattccctagctgacacattgaatcaggcattgctggcgttg
ggtatctctcagtctgtaaggacacctgaccctggacacccgtacggctttacaaacatg
cgctacattgcttccctaatcagtggtgtgggcattttcatgatgggcgcaggcctttcc
tggtaccatggaatcatgggtttgcttcatccacagccaatagaatctctgctttgggcc
tattgcatcttagcagggtcacttgtgtctgaaggagctctgaacaaattgtcctgttta
taa

DBGET integrated database retrieval system